MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. (1469-221X) 2009 imex curation Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. (1469-221X) 2009 imex curation Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. Only protein-protein interactions mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. (1469-221X) 2009 imex curation Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. (1469-221X) 2009 imex curation Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. (1469-221X) 2009 imex curation Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Burgo A., Sotirakis E., Simmler MC., Verraes A., Chamot C., Simpson JC., Lanzetti L., Proux-Gillardeaux V., Galli T. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation vamp7_human Vesicle-associated membrane protein 7 SYBL1 Synaptobrevin-like protein 1 Tetanus-insensitive VAMP VAMP7 protein protein human Homo sapiens Human MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK 9C1AA5C590375CEF rab21_human Ras-related protein Rab-21 RAB21 KIAA0118 protein protein human Homo sapiens Human MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG DIP protein Q9UL25 original sequence version: 63 73CA2C127F0CBFD6 anr27_human Ankyrin repeat domain-containing protein 27 ANKRD27 VPS9 domain-containing protein PP12899 protein protein human Homo sapiens Human MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLEKRESSEEPLAPSDPFSLKTIEDVREFLGRHSERFDRNIASFHRTFRECERKSLRHHIDSANALYTKCLQQLLRDSHLKMLAKQEAQMNLMKQAVEIYVHHEIYNLIFKYVGTMEASEDAAFNKITRSLQDLQQKDIGVKPEFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQLITQSPSQRVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSLAKDELGYCLTSFEAAIEYIRQGSLSAKPPESEGFGDRLFLKQRMSLLSQMTSSPTDCLFKHIASGNQKEVERLLSQEDHDKDTVQKMCHPLCFCDDCEKLVSGRLNDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVASLDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGSHAAEKGNSDWPERPGLTQTGPGHRRMLRRHTVEDAVVSQGPEAAGPLSTPQEVSASRS DIP protein Q96NW4 original sequence version: 80 C47A96AA15E420F9 vamp7_rat Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein rat Rattus norvegicus (Rat) Rat MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFGFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENQSLDRVTETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCVKNVKLTAIIVVVSIVFIYIIVSPLCGGFTWPSCVKK DIP protein Q9JHW5 original sequence version: 87 527D818A23224A54 vamp7-ankrd27 3 VARP 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level TI-VAMP 9 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b homomint mint vamp7-ankrd27-1 3 TI-VAMP 9 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VARP 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1b homomint mint vamp7-ankrd27-2 5 VARP 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TI-VAMP 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f1a homomint mint vamp7-ankrd27-3 4 TI-VAMP 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level VARP 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1c homomint mint vamp7-ankrd27-4 1 VARP 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level TI-VAMP 9 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1d homomint mint VARP\'s accession number has been inferred to human identifier although it has been found in rat cells. rab21-vamp7 2 TI-VAMP 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RAB21 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f2e homomint mint