MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. EMBO Rep. (1469-221X) 2009 imex curation Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. EMBO Rep. (1469-221X) 2009 imex curation Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. The Y-box factor ZONAB/DbpA associates with GEF-H1/Lfc and mediates Rho-stimulated transcription. EMBO Rep. (1469-221X) 2009 imex curation Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nie M., Aijaz S., Leefa Chong San IV., Balda MS., Matter K. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation mark/par1 Mark/Par1 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris mint q9n1q3_canlf ZONAB protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSEAGEATGTTSSSSSSLPQAPAEAAPAAPQDPAPKSPGGSGAPQAAAPPPAALAAGNPGGDAAPAATGTAAPASSAPAGGEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHHTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNAGEIGEMKEGVPEGTQLQGPVHRNPTYRPRYRRGPPRPRPAPAVGEAEDKENQQAANGPNQPSARRGYRRPYNYRRRPRPPNAPSQDGKETKAPEVPSENPAPATEQSSAE mint C49E737720F5202D zo1_canlf Tight junction protein ZO-1 TJP1 ZO1 Zonula occludens protein 1 Zona occludens protein 1 Tight junction protein 1 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSARAAAAKNTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSENEDSYDEEVHDPRSSRGGLVSRRSEKSWARDRSASRERSLSPRSDRRSVASSQPPKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRHSRSRSPDQRSEPSDHSRHSPQQPSSGSLRSREEERISKPGAVSTPVKHADDHTHKTVEEVVVERNEKQAPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDSPGFKTASQQKAEASSPVPYLSPETNPASSTSAVNHNVTLTNVRLEGPTPAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLPSHVEPAKVYRKDPYPEEMMRQNHVLKQPAVGHPGQRPDKEPNLSYESQPPYVEKQANRDLEQPTYRYDSSSYTDQFSRNYDHRLRYEERIPTYEEQWSYYDDKQPYQPRPSLDNQHPRDLDSRQHPEESSERGSYPRFEEPAPLSYDSRPRYDQPPRTSTLRHEEQPTPGYDMHNRYRPEAQSYSSAGPKASEPKQYFDQYPRSYEQVPSQGFSSKAGHYEPLHGAAVVPPLIPASQHKPEVLPSNTKPLPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLENKKDENHTAGFKPPEVASKPPGAPIIGPKPTPQNQFSEHDKTLYRIPEPQKPQMKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPSTHIPAGHLSEPAKPVHSQNQTNFSSYSSKGKSPEADAPDRSFGEKRYEPVQATPPPPPLPSQYAQPSQPGTSSSLALHTHAKGAHGEGNSISLDFQNSLVSKPDPPPSQNKPATFRPPNREDTVQSTFYPQKSFPDKAPVNGAEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKAPASPKTLAKAHSRAQPPEFDSGVETFSIHADKPKYQMNNLSTVPKAIPVSPSAVEEDEDEDGHTVVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF mint The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions 181E9F36CEBC96EF arhg2_canlf Rho guanine nucleotide exchange factor 2 ARHGEF2 Guanine nucleotide exchange factor H1 Tight junction-associated guanine nucleotide exchange factor isoform A protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSRIESLTRARTERSRELASKNREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNSTALQSVSLRSKTTPRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFSDESPLGLRRILSQSTDSLNMRNRALSVESLIDEGAEVIYSELMSDFETDERDFAADSWSLAVDSSFLQQQKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLADLLISQFSGPSAERMRKAYSEFCSRHTKALKLYKELYARDKRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLINRILQHSHGTDEERQDLTTALGLVKELLSNVDQDVHELEKGARLQEIYHRMDPRAQAPVPSKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPALDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWVRVIQQSVRVCPSREDFPLIETEDEAYLRRIKMELQQKDKALVELLREKVGLFAEMTHFQVEEDSGGVALPALPRGLFRSESLECPRGERLLQDAIREVEGLKDLLVGPGVELLLTPRDPALLVDPDSGGSTSPGVTANGEARNFNGSIELCRTDSDSSQKDRNGNQLRAPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLARANSRDGEAGRVGPAPVAPDKQATELALLQRQHALLQEELRRCRRLGEERATEAGNLEARLRESEQARALLEREAEEARRQLAILGQSEPPPAEAPWARRPLDPRRRSLPAGDALYLSFTPPQPSRGHDRLDLSVTIRSVHRPFEDRERQELGSPEERLQDSSDPDTGSEEEGGGRLSPPHSPRDFTRMQDIPEETESRDGEPMVSES mint 2D72FFB44F108290 q9n1q2_canlf ZONAB protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSEAGEATGTTSSSSSSLPQAPAEAAPAAPQDPAPKSPGGSGAPQAAAPPPAALAAGNPGGDAAPAATGTAAPASSAPAGGEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHHTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDGQFSGARSQLRRPQYRPQYRRRFPPYHVGQTFDRRSRVFPHPNRMQAGEIGEMKEGVPEGTQLQGPVHRNPTYRPRYRRGPPRPRPAPAVGEAEDKENQQAANGPNQPSARRGYRRPYNYRRRPRPPNAPSQDGKETKAPEVPSENPAPATEQSSAE mint 33E579077CF2B969 arhgef2-zonab 1 GEF-H1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ZONAB 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2a mint zonab-arhgef2 1 GEF-H1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ZONAB 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2a f2b mint arhgef2-zonab-1 3 ZONAB 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level GEF-H1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain physical association physical association f2d mint arhgef2-zonab-2 3 GEF-H1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ZONAB-B 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2e mint arhgef2-zonab-3 3 ZONAB-A 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GEF-H1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2e mint arhgef2-zonab-4 3 GEF-H1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ZONAB-B 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2f mint arhgef2-mark_par1 3 MARK 4 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level GEF-H1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain intervening domain physical association physical association mint sf4c arhgef2-mark_par1-1 3 GEF-H1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MARK 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf4d sf4e arhgef2-mark_par1-2 2 GEF-H1 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MARK 4 monoclonal immunost monoclonal antibody immunostaining monoclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3c mint arhgef2-tjp1 2 ZO-1 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell GEF-H1 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization mint sf2 sf3 sf8b