MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Dual mitochondrial localization and different roles of the reversible reaction of mammalian ferrochelatase. Dual mitochondrial localization and different roles of the reversible reaction of mammalian ferrochelatase. FEBS J. (1742-464X) 2009 Sakaino M., Ishigaki M., Ohgari Y., Kitajima S., Masaki R., Yamamoto A., Taketani S. mouse-liver Mus musculus liver liver density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Sakaino M., Ishigaki M., Ohgari Y., Kitajima S., Masaki R., Yamamoto A., Taketani S. FEBS J. (1742-464X) 2009 Dual mitochondrial localization and different roles of the reversible reaction of mammalian ferrochelatase. Dual mitochondrial localization and different roles of the reversible reaction of mammalian ferrochelatase. FEBS J. (1742-464X) 2009 Sakaino M., Ishigaki M., Ohgari Y., Kitajima S., Masaki R., Yamamoto A., Taketani S. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Sakaino M., Ishigaki M., Ohgari Y., Kitajima S., Masaki R., Yamamoto A., Taketani S. FEBS J. (1742-464X) 2009 q50dl5_chlae ATP synthase subunit a ATP6 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MNENLFTLFATPMILNQPATIPIIMFPMLLIPTSKHLINNRLITIQRNLVLFTLKQMMMIHNAKGRTWSLMLMSLITFITTTNLLGLLPHSFTPTTQLSMNLAMAIPLWAATVITGLRFKTKSSLAHLLPQGTPTLLIPMLVMIETISLIIQPVALAVRLTANITAGHLLMHLIGNATLTLLTISPPATSLVFTLLTLLTILEIAVALIQAYVFTLLISLYLHNNT mint A426649616C476D3 cox41_mouse Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Cox4i1 Cox4 Cox4a Cytochrome c oxidase subunit IV isoform 1 Cytochrome c oxidase polypeptide IV protein protein mouse Mus musculus Mouse MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport mint D30B1DBBE14FDBEA hemh_mouse Ferrochelatase, mitochondrial Fech Protoheme ferro-lyase Heme synthase protein protein mouse Mus musculus Mouse MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAATTEKVHHAKTTKPQAQPERRKPKTGILMLNMGGPETLGEVQDFLQRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQERRIGGGSPIKMWTSKQGEGMVKLLDELSPATAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNEVGQKPTMKWSTIDRWPTHPLLIQCFADHILKELNHFPEEKRSEVVILFSAHSLPMSVVNRGDPYPQEVGATVHKVMEKLGYPNPYRLVWQSKVGPVPWLGPQTDEAIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAQKCGAENIRRAESLNGNPLFSKALADLVHSHIQSNKLCSTQLSLNCPLCVNPVCRKTKSFFTSQQL Catalyzes the ferrous insertion into protoporphyrin IX mint Defects in Fech are the cause of a viable autosomal recessive mutation (named Fechm1Pas or Fch) that causes jaundice and anemia 9BC4DBD18727105A abcb7_mouse Iron-sulfur clusters transporter ABCB7, mitochondrial Abcb7 Abc7 ATP-binding cassette transporter 7 ATP-binding cassette sub-family B member 7, mitochondrial protein protein mouse Mus musculus Mouse MALLAIHSWRWAAAAVAFEKHKHSAVLTRALVSMCGSGPRWSSSQRGASGSARLSQTTESLRNTTQQRWGKDNSRQLLDATKALQTWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPEDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFEMMLVSSVLYYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNEKYEAQRYDGFLKTYETASLKSTSTLAMLNFGQNAIFSVGLTAIMVLASQGIVAGALTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTRIKDKVMAPPLQITPQTATVAFDNVHFEYIEGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNLQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNINASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPVILYDEATSSLDSITEETILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTHYGLLANSSSIYSEMWHTQSNRVQNQDSLGWDAKKESLSKEEERKKLQEEIVNSVKGCGNCSC 79B2BC8A7A07555A nb5r3_mouse NADH-cytochrome b5 reductase 3 Cyb5r3 Dia1 Diaphorase-1 protein protein mouse Mus musculus Mouse MGAQLSTLSHVVLSPVWFIYSLFMKLFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFTF DIP protein Q9DCN2 original sequence version: 98 984D5B73430F725D atp6-fech 2 ATP synthase 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Ferrochelatase 5 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f1a mint abcb7-cox4i1 1 Ferrochelatase 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level COXIV 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Abcb7 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level b5 reductase 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization homomint f2a f2c mint abcb7-cyb5r3 1 Ferrochelatase 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level b5 reductase 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Abcb7 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization homomint f2a f2c mint