MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. FEBS J. (1742-464X) 2009 Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. suggested by aryamontri in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. suggested by aryamontri FEBS J. (1742-464X) 2009 Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. FEBS J. (1742-464X) 2009 Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. suggested by aryamontri in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. suggested by aryamontri FEBS J. (1742-464X) 2009 Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. FEBS J. (1742-464X) 2009 Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. suggested by aryamontri in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. suggested by aryamontri FEBS J. (1742-464X) 2009 gast_human Gastrin GAST GAS protein protein human Homo sapiens Human MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN A03C847FCFE7216C trfe_human Serotransferrin Siderophilin Beta-1 metal-binding globulin TF PRO1400 protein protein human Homo sapiens Human MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP DIP protein P02787 original sequence version: 123 DIP protein P02787 original sequence version: 144 DIP protein P02787 original sequence version: 156 DIP protein P02787 original sequence version: 165 DIP protein P02787 original sequence version: 161 DIP protein P02787 original sequence version: 170 9A73B90D8C5671E9 gast-tf 3 Apo-transferrin 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7152953]The shifted ranges (20-698) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7152953]20-698 [EBI-7152953]P02787,2 Gamide 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain other modification uncategorized protein modification uncategorized protein modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm direct interaction direct interaction homomint mint F1A F2 gast-tf-1 3 Ggly 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Apo-transferrin 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7152997]The shifted ranges (20-698) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7152997]20-698 [EBI-7152997]P02787,2 direct interaction direct interaction homomint mint F1A F2 gast-tf-2 1 Ggly 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Apo-transferrin 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7153027]The shifted ranges (20-698) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7153027]20-698 [EBI-7153027]P02787,2 P02787:p.Tyr115Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:05:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:28:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr115phe' Tue Jun 30 20:26:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr115Phe' undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:01:50 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was mutation decreasing Tyr208Phe direct interaction direct interaction homomint mint F1C F4 gast-tf-3 1 Apo-transferrin 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:01:47 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was mutation decreasing Tyr537Phe apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7153075]The shifted ranges (20-698) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7153075]20-698 [EBI-7153075]P02787,2 undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:01:31 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was mutation decreasing Tyr446Phe Ggly 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint F1C F4 gast-tf-4 2 Apo-transferrin 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7153108]The shifted ranges (20-698) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7153108]20-698 [EBI-7153108]P02787,2 Ggly 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P01350:p.Glu81Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:49:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:54:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu81ala' Tue Jun 30 16:50:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu81Ala' gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F3A homomint mint