MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. EMBO Rep. (1469-221X) 2009 imex curation Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri Only protein-protein interactions unknown Unknown x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. EMBO Rep. (1469-221X) 2009 imex curation Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. EMBO Rep. (1469-221X) 2009 imex curation Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. EMBO Rep. (1469-221X) 2009 imex curation Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation kpce_human Protein kinase C epsilon type nPKC-epsilon PRKCE PKCE protein protein human Homo sapiens Human MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP DIP protein Q02156 original sequence version: 154 DIP protein Q02156 original sequence version: 119 85032D0A091A1F7F 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 prkce-ywhaz 4 14-3-3 zeta 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified PKC-epsilon 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F1B homomint domino mint prkce-ywhaz-1 3 14-3-3 zeta 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified PKC-epsilon 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F1C homomint domino mint prkce-ywhaz-2 2 14-3-3 zeta 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified PKC-epsilon 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction ST1 homomint domino mint prkce-ywhaz-3 1 KPCE_HUMAN 5 unspecified role unspecified role unspecified role unspecified role 1433Z_HUMAN 6 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint prkce-ywhaz-4 1 KPCE_HUMAN 5 unspecified role unspecified role unspecified role unspecified role 1433Z_HUMAN 6 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint