IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Cell (0092-8674) 2009 imex curation Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr Accepted 2009-SEP-12 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 13 imex curation Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Cell (0092-8674) 2009 imex curation Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. Further details on experiment were taken from PMID: 19596236 however in neither publication was the cell line given that proteins were immunoprecipitated from. It can be inferred that they were of human origin, as protein were identified by accession number. gaillard@ifr88.cnrs-mrs.fr Accepted 2009-SEP-12 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 13 imex curation Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Cell (0092-8674) 2009 imex curation Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 13 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. Tagged bait proteins identified by anti-tag antibodies. gaillard@ifr88.cnrs-mrs.fr Accepted 2009-SEP-12 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 13 imex curation Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Cell (0092-8674) 2009 imex curation Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 13 human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line confocal microscopy confocal microscopy immunostaining immunostaining Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr Accepted 2009-SEP-12 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 13 imex curation Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Cell (0092-8674) 2009 imex curation Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 13 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr Accepted 2009-SEP-12 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 13 imex curation eme1_human Crossover junction endonuclease EME1 EME1 MMS4 MMS4 homolog protein protein human Homo sapiens Human MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISDCEASCPPAPELFSPPVPEIAETVTQTQPVRLLSSESEDEEEFIPLAQRLTCKFLTHKQLSPEDSSSPVKSVLDHQNNEGASCDWKKPFPKIPEVPLHDTPERSAADNKDLILDPCCQLPAYLSTCPGQSSSLAVTKTNSDILPPQKKTKPSQKVQGRGSHGCRQQRQARQKESTLRRQERKNAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD DIP protein Q96AY2 original sequence version: 73 BA08F5655761AF85 slx1_human Structure-specific endonuclease subunit SLX1 GIYD1 GIYD2 SLX1 GIY-YIG domain-containing protein 1 SLX1A SLX1B protein protein human Homo sapiens Human MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET 57DF055F2E59CF70 slx1_drome Structure-specific endonuclease subunit SLX1 homolog CG18271 slx1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSYDPQDTASQQEESVALKGHFYGVYLLCSQSLDPRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRKGPWLMVMIVHGFPNNTVALQFEWAWQQPSLSTRLKMYPELKRKLPRETFFDYNFRILSNMLGVGPWNRLPLTVRWLETDYERPFSKALPKHMEIVSGKVSISASQRRRPDDAVPPPPVAWASECHLCMQEMEQPEKSRLGCTNQMCRLTCHMVCLANYLLGDEPGHYIPVGGECPLCETRLSWAALLQRKRLLLGVPEELQDHDEDLSDDIDVDSDIEDTPELSD 0E40C46284DF3D5D xpf_human DNA repair endonuclease XPF ERCC4 ERCC11 XPF DNA excision repair protein ERCC-4 DNA repair protein complementing XP-F cells Xeroderma pigmentosum group F-complementing protein protein protein human Homo sapiens Human MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVLVLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLTDRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVERVMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKELKCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQYDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEKMEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQLRDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERASTKERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSSDAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPGKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEISSNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK DIP protein Q92889 original sequence version: 109 DIP protein Q92889 original sequence version: 127 DIP protein Q92889 original sequence version: 166 C58CDE900378CCA8 ercc1_human DNA excision repair protein ERCC-1 ERCC1 protein protein human Homo sapiens Human MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP DIP protein P07992 original sequence version: 109 DIP protein P07992 original sequence version: 69 DIP protein P07992 original sequence version: 162 6FCE3615732349E5 slx4_human Structure-specific endonuclease subunit SLX4 SLX4 BTB/POZ domain-containing protein 12 BTBD12 KIAA1784 KIAA1987 protein protein human Homo sapiens Human MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQRVKKHGIKEVSGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTRENVPNSDSQPPPSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREENVPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQKNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKMEVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSEDLLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTGRQIEDRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAWAMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGPSPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHEEDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQWDKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSSPSRDCQAERKEGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSHRLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPSKQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQKSSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCELFSIIDVDADQEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPATPLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQTPSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPGPSFLNQTPAGEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQEKSSGAGSLGNSRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPKGANRKKNLPPKVPITPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSSQPLLQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSRSPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDFLDTHCITFTTAATRREKLQGRRRQPRGKKKVERN 9131E88628DB15D5 q7ytz1_drome mus312 mus312-RD Dmel_CG8601 Dmel\CG8601 MUS312 mus(3)312 CG8601 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDRKTRRANFKNLQPRLTRSTKAAADTLSLSNFFATPENAEEVPSCLADIPVQPDPPAPKIKPIRTSNVFEKPGPKPKKAPKLKASTVSTSSGARRGRGKSKQQPSISNFLRNEQIFAEVTAQHCMADNFSADDIEMALALSKSESEKHGRLRLHDDDDAVVDLLDDEEKSTERIRHKLQKYGFRTAAKEDYKSLAVLPVVASKGGRRGKWANRFTSLTLRNPDVQQKKLEEKVSALLGQEMRGKEPNGEDCCLTPYTVITAALKELRAEGESRILREPSEGPIDDLESYYVTDLFEVSRTPAHHLLKNWAAIQGRDFSPERETQKCRQLRQQHELVYAELERYYGDPQKLEEEVMQELDELEKLVADNMIEDDSVVINIVEAESSSTGSSPSKEPPDKRPKMTMEDKENLQPTTSKASLTVPAQSTRCTSPDLFADSEDEPDIVTTAISNEPEDVRNLSMKVYKNVSISERSSSVAEIEIVSSNDEPSQITTYEVFSSDEDCFQRYAGEDFF A933C17C533388A9 mus81_human Crossover junction endonuclease MUS81 MUS81 protein protein human Homo sapiens Human MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSGKEAKILQHFGDGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSARPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIGPKEPPGEETAVPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGPLT DIP protein Q96NY9 original sequence version: 81 D0F331CC2269D847 terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN DIP protein Q15554 original sequence version: 107 DIP protein Q15554 original sequence version: 109 DIP protein Q15554 original sequence version: 121 DIP protein Q15554 original sequence version: 157 DIP protein Q15554-3 original sequence version: 115 3A278AC6B594C43A mus312-slk1-1 1 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Y2H analysis of interactions between MUS312 fused to the GAL4 activation domain (AD) and D. melanogaster SLX1 fused to the GAL4 DNA-binding domain (DBD). Fig. 1B btbd12-giyd1-1 1 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Figs. 2A, 2B We found that human BTBD12 has a Y2H interaction with human SLX1 (Figure 2A) btbd12-giyd1-2 5 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C Immunoprecipitation of the indicated FLAG-tagged SLX1 proteins overproduced in HEK cells along with the indicated GFP-tagged SLX4 proteins. btbd12-giyd1-3 3 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C, Supp. Fig. 4 XPF readily coprecipitated with SLX1-SLX4 but not SLX1-SLX4-4 (Figure 2C), Supp Fig 4 appears to be the Coomassie staining of the gel that was then western blotted so I have not entered it separately. btbd12-ercc4-3 1 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Figs. 2D, 2E Y2H analysis of interaction between XPF fused to GAL4-DBD and the indicated SLX4 fragments fused to GAL4-AD. eme1-mus81-1 2 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association We found that both SLX1 and SLX4 were among the proteins present in partially purified human EME1 preparations (Figure 6A). Fig. 6A giyd1-mus81-1 3 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role ancillary ancillary region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association These data suggested that the association of MUS81 with the SLX1-SLX4 complex is mediated through SLX4 rather than SLX1 and involves the SAP domain of SLX4. Fig. 6B btbd12-mus81-2 5 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association MUS81 binding to SLX4 was further supported by the efficient copurification of HA-MUS81 with FLAG-SLX4 (Figure 6C) Fig. 6C eme1-btbd12-1 5 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association We further found that while GFP-SLX4 coprecipitated with full-length FLAG-EME1, it did not coprecipitate with the FLAG-EME1 (1�467) fragment that cannot bind to MUS81 Fig. 6D btbd12-ercc1-2 3 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey association association Supp. Figs. 3 and 16 ERCC1 also coprecipitated with SLX4 and not SLX4-4, indicating that SLX4 interacts with XPF-ERCC1 (Figure S3). btbd12-terf2-4 3 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Supp. Figs. 3 and 16 ERCC1 also coprecipitated with SLX4 and not SLX4-4, indicating that SLX4 interacts with XPF-ERCC1 (Figure S3). btbd12-ercc1-4 3 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey association association Supp. Figs. 3 and 16 ERCC1 also coprecipitated with SLX4 and not SLX4-4, indicating that SLX4 interacts with XPF-ERCC1 (Figure S3). btbd12-giyd1-4 4 11 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp. Fig. 2 SLX1 and SLX4 colocalized in the nucleus (Figure S2).