MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Coiled-coil interactions are required for post-Golgi R-SNARE trafficking. Coiled-coil interactions are required for post-Golgi R-SNARE trafficking. EMBO Rep. (1469-221X) 2009 imex curation Gordon DE., Mirza M., Sahlender DA., Jakovleska J., Peden AA. suggested by aryamontri Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gordon DE., Mirza M., Sahlender DA., Jakovleska J., Peden AA. suggested by aryamontri EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation stx8_human Syntaxin-8 STX8 protein protein human Homo sapiens Human MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN DIP protein Q9UNK0 original sequence version: 153 DIP protein Q9UNK0 original sequence version: 119 DIP protein Q9UNK0 original sequence version: 100 DIP protein Q9UNK0 original sequence version: 114 1E64A0DA77584CC4 vamp4_human Vesicle-associated membrane protein 4 VAMP4 protein protein human Homo sapiens Human MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT DIP protein O75379 original sequence version: 118 DIP protein O75379 original sequence version: 128 DIP protein O75379 original sequence version: 133 556CC682D26CF91E stx6_human Syntaxin-6 STX6 protein protein human Homo sapiens Human MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL DIP protein O43752 original sequence version: 117 DIP protein O43752 original sequence version: 129 DIP protein O43752 original sequence version: 134 CC05C025DE1FE89E vamp7_human Vesicle-associated membrane protein 7 SYBL1 Synaptobrevin-like protein 1 Tetanus-insensitive VAMP VAMP7 protein protein human Homo sapiens Human MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK 9C1AA5C590375CEF vamp3_human Vesicle-associated membrane protein 3 Synaptobrevin-3 Cellubrevin VAMP3 SYB3 protein protein human Homo sapiens Human MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS DIP protein Q15836 original sequence version: 141 347E9163157AFF42 vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS DIP protein Q9BV40 original sequence version: 108 DIP protein Q9BV40 original sequence version: 118 DIP protein Q9BV40 original sequence version: 100 018B986442BBD9B6 stx7_human Syntaxin-7 STX7 protein protein human Homo sapiens Human MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH DIP protein O15400 original sequence version: 123 DIP protein O15400 original sequence version: 116 42AC173F0233ACDA vamp4-stx6 1 VAMP4 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75379:p.Val56Pro mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V P Tue Jul 12 10:09:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:08:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val56pro' Tue Jun 30 19:39:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val56Pro' O75379:p.Val63Pro mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V P Tue Jul 12 10:08:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:36:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val63pro' Tue Jun 30 17:15:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val63Pro' O75379:p.Leu91Pro mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:50:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:45:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu91pro' Tue Jun 30 19:11:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu91Pro' undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:44 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Leu24Ala O75379:p.Leu84Pro mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:08:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:53:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu84pro' Tue Jun 30 17:12:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu84Pro' O75379:p.Leu25Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:08:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:08:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu25ala' Tue Jun 30 18:47:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu25Ala' STX6 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX8 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F2C homomint mint vamp7-stx6 1 STX6 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level VAMP7 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P51809:p.Thr129Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T P Tue Jul 12 10:22:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:30:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr129pro' Tue Jun 30 17:32:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr129Pro' P51809:p.Leu136Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:22:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:07:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu136pro' Tue Jun 30 17:44:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu136Pro' ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P51809:p.Leu157Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:22:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:32:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu157pro' Tue Jun 30 17:47:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu157Pro' P51809:p.Leu164Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:22:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:50:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu164pro' Tue Jun 30 16:02:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu164Pro' STX8 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F3B homomint mint vamp3-stx6 1 STX6 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level VAMP3 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q15836:p.Leu53Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:24:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:07:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu53pro' Tue Jun 30 16:11:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu53Pro' Q15836:p.Val25Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V P Tue Jul 12 10:24:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:05:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val25pro' Tue Jun 30 19:23:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val25Pro' Q15836:p.Thr18Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T P Tue Jul 12 10:59:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:06:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr18pro' Tue Jun 30 20:06:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr18Pro' ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15836:p.Leu46Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:24:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:49:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu46pro' Tue Jun 30 17:42:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu46Pro' STX8 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F3B homomint mint vamp8-stx6 1 VAMP8 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q9BV40:p.Leu16Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:24:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:14:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu16pro' Tue Jun 30 15:45:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu16Pro' ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BV40:p.Leu44Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:24:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:21:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu44pro' Tue Jun 30 16:07:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu44Pro' Q9BV40:p.Leu51Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:24:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:00:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu51pro' Tue Jun 30 17:08:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu51Pro' Q9BV40:p.Val20Pro mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V P Tue Jul 12 10:23:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:24:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val20pro' Tue Jun 30 19:54:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val20Pro' STX8 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX6 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F3B homomint mint vamp3-stx6-1 1 STX8 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level VAMP3 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q15836:p.Met29Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Tue Jul 12 10:54:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:28:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met29ala' Tue Jun 30 18:17:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met29Ala' undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:53:12 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Trp26Ala ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined STX6 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level STX7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F4B homomint mint