MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic. How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic. EMBO J. (0261-4189) 2009 imex curation Regni CA., Roush RF., Miller DJ., Nourse A., Walsh CT., Schulman BA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Regni CA., Roush RF., Miller DJ., Nourse A., Walsh CT., Schulman BA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic. How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic. EMBO J. (0261-4189) 2009 imex curation Regni CA., Roush RF., Miller DJ., Nourse A., Walsh CT., Schulman BA. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Regni CA., Roush RF., Miller DJ., Nourse A., Walsh CT., Schulman BA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation mccc7_ecolx Microcin C7 mccA Microcin C51 protein protein ecolx Escherichia coli MRTGNAN mint 644DD44861B406F0 q47506_ecolx mccB protein protein ecolx Escherichia coli MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRM mint 076132546850AB2E mccb-1 1 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction mint t1 mcca-mccb 1 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.1 MccA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.2 direct interaction direct interaction mint f2 f3a f4 t1 mcca-mccb-1 2 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Cys123Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C L Tue Jul 12 10:24:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:14:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123leu' Tue Jun 30 18:12:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys123Leu' Stoichiometry: 2.1 MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 1.2 enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b mcca-mccb-2 2 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Tyr239Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:15:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:06:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr239ala' Tue Jun 30 18:25:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr239Ala' MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b mcca-mccb-3 2 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Lys10Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:16:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:21:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys10ala' Tue Jun 30 20:19:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys10Ala' MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b mcca-mccb-4 2 MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Asp214Ala mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:55:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:27:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp214ala' Tue Jun 30 16:25:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp214Ala' enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b mcca-mccb-5 2 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Asn241Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:17:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:20:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn241ala' Tue Jun 30 17:54:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn241Ala' MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b mcca-mccb-6 2 MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Arg94Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:16:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:29:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg94ala' Tue Jun 30 16:55:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg94Ala' MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b mcca-mccb-7 2 MccA 3 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified MccB 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.His215Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:18:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:05:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his215ala' Tue Jun 30 18:01:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His215Ala' enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction mint t2 f5b f5c f5d f7b