MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling. SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling. Exp. Cell Res. (0014-4827) 2009 mimix curation Teodorof C., Bae JI., Kim SM., Oh HJ., Kang YS., Choi J., Chun JS., Song WK. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Teodorof C., Bae JI., Kim SM., Oh HJ., Kang YS., Choi J., Chun JS., Song WK. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Exp. Cell Res. (0014-4827) 2009 partial coverage mimix curation mimix curation SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling. SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling. Exp. Cell Res. (0014-4827) 2009 mimix curation Teodorof C., Bae JI., Kim SM., Oh HJ., Kang YS., Choi J., Chun JS., Song WK. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Teodorof C., Bae JI., Kim SM., Oh HJ., Kang YS., Choi J., Chun JS., Song WK. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Exp. Cell Res. (0014-4827) 2009 partial coverage mimix curation mimix curation SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling. SPIN90-IRSp53 complex participates in Rac-induced membrane ruffling. Exp. Cell Res. (0014-4827) 2009 mimix curation Teodorof C., Bae JI., Kim SM., Oh HJ., Kang YS., Choi J., Chun JS., Song WK. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Teodorof C., Bae JI., Kim SM., Oh HJ., Kang YS., Choi J., Chun JS., Song WK. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci Exp. Cell Res. (0014-4827) 2009 partial coverage mimix curation mimix curation rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 baip2_human Brain-specific angiogenesis inhibitor 1-associated protein 2 Insulin receptor substrate protein of 53 kDa Insulin receptor substrate p53/p58 Fas ligand-associated factor 3 BAIAP2 protein protein human Homo sapiens Human MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR DIP protein Q9UQB8 original sequence version: 87 3B9EDC6405DCC99D baip2_crigr Brain-specific angiogenesis inhibitor 1-associated protein 2 BAIAP2 Insulin receptor tyrosine kinase 53 kDa substrate Insulin receptor substrate protein of 53 kDa p58/p53 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTFAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQAEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPVWQQACADPNKIPDRAVQLMQQIASSNGSILPSTLSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQENVPVMNGVAGPDSEDYNPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAVPPPDYGTSSRAFPTQTAGTFKQRPYSVAVPAFSQGLDDYGARSVSSADVEVARF mint Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation 58485BD6CAC15DC1 spn90_human NCK-interacting protein with SH3 domain NCKIPSD AF3P21 SPIN90 54 kDa VacA-interacting protein 54 kDa vimentin-interacting protein 90 kDa SH3 protein interacting with Nck AF3p21 Dia-interacting protein 1 Diaphanous protein-interacting protein SH3 adapter protein SPIN90 WASP-interacting SH3-domain protein Wiskott-Aldrich syndrome protein-interacting protein protein protein human Homo sapiens Human MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPTTPPPPVKRRDREALMASGSGGHNTMPSGGNSVSSGSSVSSTSLDTLYTSSSPSEPGSSCSPTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGTTSASDDLEALGTLSLGTTEEKAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASSPVMEQVLLSLVEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQCQMDRMIVREMCKEFLVLGEAPS 7683046B94647332 nckipsd-baiap2 2 irsp53 6 unspecified role unspecified role prey prey ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPIN90 7 unspecified role unspecified role bait bait myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1c mint baiap2-nckipsd-1 3 irsp53 5 unspecified role unspecified role bait bait SPIN90 7 unspecified role unspecified role prey prey physical association physical association f1d homomint mint we have inferred proteins\' accession number to homo, but they have been detected in COS-7 cells. rac1-nckipsd 1 SPIN90 7 unspecified role unspecified role prey prey myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rac1 4 unspecified role unspecified role bait bait gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3d homomint mint we have inferred spin90\'s accession number to homo, but it has been detected in COS-7 cells. nckipsd-baiap2-1 1 rac1 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPIN90 7 unspecified role unspecified role bait bait gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f4a mint baiap2-nckipsd-2 1 irsp53 6 unspecified role unspecified role bait bait gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPIN90 7 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4b mint