MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Isolation and characterization of cytoplasmic cyclin D1 mutants. Isolation and characterization of cytoplasmic cyclin D1 mutants. FEBS Lett. (0014-5793) 2009 Murakami H., Horihata M., Andojo S., Yoneda-Kato N., Kato JY. suggested by aryamontri mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Murakami H., Horihata M., Andojo S., Yoneda-Kato N., Kato JY. suggested by aryamontri FEBS Lett. (0014-5793) 2009 ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI DIP protein P25322 original sequence version: 139 DIP protein P25322 original sequence version: 123 DIP protein P25322 original sequence version: 75 3A79736B4163251B cdk4-ccnd1-11 1 Cdk4 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Cdk1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F6 mint cdk4-ccnd1-12 1 Cdk4 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Cyclin D1 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P24385:p.Ala211Val mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V Tue Jul 12 10:19:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:35:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala211val' Tue Jun 30 18:15:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala211Val' range MINT-7033532: original sequence: 211-211 : SMVAAGSVVAAVQGLNLRSP gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P24385:p.Ala210Val mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V Tue Jul 12 10:19:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:36:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala210val' Tue Jun 30 19:03:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala210Val' range MINT-7033529: original sequence: 210-210 : PSMVAAGSVVAAVQGLNLRS P24385:p.Ala154Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T Tue Jul 12 10:19:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:54:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala154thr' Tue Jun 30 18:38:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala154Thr' range MINT-7033526: original sequence: 154-154 : LVNKLKWNLAAMTPHDFIEH P24385:p.Leu101Pro mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Tue Jul 12 10:17:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:36:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu101pro' Tue Jun 30 19:06:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu101Pro' range MINT-7033523: original sequence: 101-101 : LEPVKKSRLQLLGATCMFVA physical association physical association F6 mint cdk4-ccnd1-13 1 Cyclin D1 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P24385:p.Leu144Met mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L M Tue Jul 12 10:17:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:25:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu144met' Tue Jun 30 17:00:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu144Met' range MINT-7033538: original sequence: 144-144 : PEELLQMELLLVNKLKWNLA P24385:p.Val193Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E Tue Jul 12 10:55:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:14:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val193glu' Tue Jun 30 19:10:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val193Glu' range MINT-7033565: original sequence: 193-193 : QTFVALCATDVKFISNPPSM P24385:p.Thr128Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:17:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:14:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr128ala' Tue Jun 30 16:13:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr128Ala' range MINT-7033540: original sequence: 128-128 : PLTAEKLCIYTDNSIRPEEL gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P24385:p.Ala121Thr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A T Tue Jul 12 10:17:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:42:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala121thr' Tue Jun 30 15:51:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala121Thr' range MINT-7033544: original sequence: 121-121 : SKMKETIPLTAEKLCIYTDN P24385:p.Ile161Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I F Tue Jul 12 10:55:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:12:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile161phe' Tue Jun 30 20:17:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile161Phe' range MINT-7033542: original sequence: 161-161 : NLAAMTPHDFIEHFLSKMPE P24385:p.Ala187Val mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A V Tue Jul 12 10:17:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:55:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala187val' Tue Jun 30 18:57:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala187Val' range MINT-7033563: original sequence: 187-187 : IIRKHAQTFVALCATDVKFI Cdk4 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F6 mint