MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. EMBO J. (0261-4189) 2009 imex curation Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. EMBO J. (0261-4189) 2009 imex curation Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. EMBO J. (0261-4189) 2009 imex curation Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. MAPKAP kinase MK2 maintains self-renewal capacity of haematopoietic stem cells. EMBO J. (0261-4189) 2009 imex curation Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Schwermann J., Rathinam C., Schubert M., Schumacher S., Noyan F., Koseki H., Kotlyarov A., Klein C., Gaestel M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation mk14_mouse Mitogen-activated protein kinase 14 Mapk14 Crk1 Csbp1 Csbp2 Mitogen-activated protein kinase p38 alpha CRK1 protein protein mouse Mus musculus Mouse MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES DIP protein P47811 original sequence version: 162 DIP protein P47811 original sequence version: 127 DIP protein P47811 original sequence version: 173 DFB03EBCE97BB51A phc2_mouse Polyhomeotic-like protein 2 p36 Early development regulatory protein 2 Phc2 Edr2 Ph2 protein protein mouse Mus musculus Mouse MENELPVPHTSNRASVTTNTSGTNSSSGCISSSGGGGGSGGRPTAPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTPGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPPTQPVLPSLALKPTPSSSQPLPAPPQGRTMAQGSPAGAKPSGTDNAPETLKAGDGNCNMEGRPGPGRAVPAVATHPLIAPAYAHLQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQSQPQLASVSPSLALQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQNGHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAEKSVPVARPGPSPHQQAIIPAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKPPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLDLPDMHMRDLVGVGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS 87746AFD7808DC7B mapk2_human MAP kinase-activated protein kinase 2 MAPKAPK2 protein protein human Homo sapiens Human MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH E4EFFF11CCF288DC q09hn3_mouse Mapkapk3 protein protein mouse Mus musculus Mouse MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQKCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMECMEGGELFSRIQERGDQAFTEREAAEIMREIGTAIQFLHSRNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILNPWWSHRPHSTQPECSRKTKITGMTSRKR mint 84434AD2D815990E bmi1_mouse Polycomb complex protein BMI-1 Bmi1 Pcgf4 Bmi-1 Polycomb group RING finger protein 4 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG DIP protein P25916 original sequence version: 81 DIP protein P25916 original sequence version: 133 AD7DECDB6B29DCE5 ring2_human E3 ubiquitin-protein ligase RING2 RING finger protein 2 RING finger protein 1B RING finger protein BAP-1 Protein DinG Huntingtin-interacting protein 2-interacting protein 3 RNF2 BAP1 DING HIPI3 RING1B RING-type E3 ubiquitin transferase RING2 protein protein human Homo sapiens Human MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q99496 original sequence version: 95 DIP protein Q99496 original sequence version: 94 DIP protein Q99496 original sequence version: 96 DIP protein Q99496 original sequence version: 125 DIP protein Q99496 original sequence version: 142 DIP protein Q99496 original sequence version: 159 DIP protein Q99496 original sequence version: 129 DIP protein Q99496 original sequence version: 99 DIP protein Q99496 original sequence version: 118 90EA546E1F4DB7EC mapk2_mouse MAP kinase-activated protein kinase 2 Mapkapk2 Rps6kc1 protein protein mouse Mus musculus Mouse MLSGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAITDDYKVTSQVLGLGINGKVLRIFDKRTQQKFALKMLQDCPKARREVELHWRASQCPHIVHIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARAVEDAALAH ED7827641A826BF3 phc1_mouse Polyhomeotic-like protein 1 Phc1 Edr Edr1 Rae28 Early development regulatory protein 1 RAE-28 protein protein mouse Mus musculus Mouse METESEQNSSSTNGSSSSGASSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSLAAVQQATIAASRQASSPNSSTAQQQTATTQASMNLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPPAQSPGVHADADQVQNLAVRNQQASAQGPQMPGSTQKAIPPGASPVSGLSQTSSQALAVAQASSGASGQSLNLSQAGGGSGNSLPGSMGPGGGGQAPGGLGQLPSSGLTGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQSVGMNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQQQQQQQQQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLTLPPEPTSKPPIPIQSKPPVAPIKPPQLGAAKMSATQQPPPHIPVQVVGTRQPGSAQAQALGLAQLAAAVPTPRGITGAVQPGQAHLASSPPSSQAAPGALQECPPALAAGMTLAPVQGTAHVVKGGPTASSPVVAQVPAAFYMQSVHLPGKAQTLAVKRKAESEEERDDLSALASVLPTKASPAAESPKVIEEKNSLGEKAEPVASLNANPPNSDLVALAPTPSAPPPTLALVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQFLKETEKPLQAGLPTGLNESQPSGPLGGDSPSVELEKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEASYARVRRRGPRRSSSDIARAKIQGKRHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNTITTPSTPELQGINPVFLSSNPSQWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET DIP protein Q64028 original sequence version: 119 5DA12A87D0B5FDDB phc2_human Polyhomeotic-like protein 2 Early development regulatory protein 2 PHC2 EDR2 PH2 protein protein human Homo sapiens Human MENELPVPHTSSSACATSSTSGASSSSGCNNSSSGGSGRPTGPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVSNRQGSTSGSNVSAQAPAQSSSINLAASPAAAQLLNRAQSVNSAAASGIAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELGTGSPARPPTPAQVQNLTLRTQQTPAAAASGPTPTQPVLPSLALKPTPGGSQPLPTPAQSRNTAQASPAGAKPGIADSVMEPHKKGDGNSSVPGSMEGRAGLSRTVPAVAAHPLIAPAYAQLQPHQLLPQPSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQCHPPTPDTGPQNGHPEGVPHTPQRRFQHTSAVILQLQPASPPQQCVPDDWKEVAPGEKSVPETRSGPSPHQQAIVTAMPGGLPVPTSPNIQPSPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS DIP protein Q8IXK0 original sequence version: 67 2E3FD3898CFD702B mapkapk2-phc2 1 MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Edr2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction homomint mint f4A mapkapk2-phc1 1 Edr1 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction mint f4A mapkapk2-mapk14 1 MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p38 alpha 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction homomint mint f4A mapkapk2-phc2-1 1 Edr2 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f4B mapkapk3-phc2 1 MK3 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Edr2 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association mint f4B bmi1-phc2-2 1 Edr2 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Bmi1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f4B phc2-mapkapk2 1 MK2 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Edr2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f6B phc2-mapkapk2-1 1 Edr2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MK2 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint f6B mapkapk2-rnf2 1 RING1B 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f4D mapkapk2-phc2-2 2 MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Edr2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint NFA mapkapk2-phc1-1 2 Edr1 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint NFA mapkapk2-mapk14-1 2 MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p38 alpha 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint NFA mapkapk2-phc2-3 4 Edr2 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint f4C mapkapk2-phc2-4 3 Edr2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F5A homomint mint mapkapk2-phc2-5 3 Edr2 6 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MK2 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint F5B