IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHsps. Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHsps. Plant J. (0960-7412) 2009 imex curation Meiri D., Breiman A. adina@post.tau.ac.il 01-Sep-2009: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Meiri D., Breiman A. adina@post.tau.ac.il Accepted 2009-SEP-18 by JYOTI. 01-Sep-2009: Contacted by JYOTI. Plant J. (0960-7412) 2009 jyoti Only protein-protein interactions imex curation Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHsps. Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHsps. Plant J. (0960-7412) 2009 imex curation Meiri D., Breiman A. adina@post.tau.ac.il 01-Sep-2009: Contacted by JYOTI. jyoti Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Meiri D., Breiman A. adina@post.tau.ac.il Accepted 2009-SEP-18 by JYOTI. 01-Sep-2009: Contacted by JYOTI. Plant J. (0960-7412) 2009 jyoti Only protein-protein interactions imex curation Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHsps. Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHsps. Plant J. (0960-7412) 2009 imex curation Meiri D., Breiman A. adina@post.tau.ac.il 01-Sep-2009: Contacted by JYOTI. jyoti Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Meiri D., Breiman A. For BiFC, 2 days after injection, the whole plant was incubated for 3 h at 37 degrees celcius in an incubator with high humidity to avoid drought stress. For RNA preparation and protein extraction, 5-day-old seedlings were incubated for 3 h at 37 degrees celcius in an incubator, and then returned to recovery conditions of 22 degrees celcius under long days (16 h light, 8 h dark) for various durations adina@post.tau.ac.il Accepted 2009-SEP-18 by JYOTI. 01-Sep-2009: Contacted by JYOTI. Plant J. (0960-7412) 2009 jyoti Only protein-protein interactions imex curation hsfa2_arath Heat stress transcription factor A-2 HSFA2 HSF04 AtHsf-04 T19L18.4 At2g26150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEELKVEMEEETVTFTGSVAASSSVGSSSSPRPMEGLNETGPPPFLTKTYEMVEDPATDTVVSWSNGRNSFVVWDSHKFSTTLLPRYFKHSNFSSFIRQLNTYGFRKIDPDRWEFANEGFLAGQKHLLKNIKRRRNMGLQNVNQQGSGMSCVEVGQYGFDGEVERLKRDHGVLVAEVVRLRQQQHSSKSQVAAMEQRLLVTEKRQQQMMTFLAKALNNPNFVQQFAVMSKEKKSLFGLDVGRKRRLTSTPSLGTMEENLLHDQEFDRMKDDMEMLFAAAIDDEANNSMPTKEEQCLEAMNVMMRDGNLEAALDVKVEDLVGSPLDWDSQDLHDMVDQMGFLGSEP 455FAB34582D7150 fkb62_arath Peptidyl-prolyl cis-trans isomerase FKBP62 FKBP62 70 kDa peptidyl-prolyl isomerase FK506-binding protein 62 Immunophilin FKBP62 Peptidylprolyl isomerase ROF1 Protein ROTAMASE FKBP 1 ROF1 Rotamase MJL12.19 At3g25230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDANFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEIQQGLKKKLLKEGEGYETPENGDEVEVHYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGESGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLSKE 36CF13637466D286 hs901_arath Heat shock protein 90-1 HSP90-1 HSP83 F6N7.13 At5g52640 Heat shock protein 83 HSP81-1 Heat shock protein 81-1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKTTEKEISDDEDEDEPKKENEGEVEEVDEEKEKDGKKKKKIKEVSHEWELINKQKPIWLRKPEEITKEEYAAFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLSFVKGVVDSDDLPLNISRETLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSKNLKLGIHEDSQNRGKIADLLRYHSTKSGDEMTSFKDYVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD DIP protein P27323 original sequence version: 127 5B379E915757EC7B rof1-hsp90_1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2409402]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 552-552, sequence length 551 [EBI-2409402]390-552 undefined mutation lys404ala asn408asp asn454asp asp484asp arg488ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:44 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'region' physical association physical association Figure 1 ROF1 interacts with AtHSP90.1 in yeast cells rof1-hsp90_1-1 2 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2 ROF1 and AtHSP90.1 interact in the plant cytoplasm. rof1-hsp90_1-2 3 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3 As expression of both HSP90.1 and ROF1 is heat-induced, we tested the interaction of HSP90.1 and ROF1 by the BiFC method after exposing the plants to heat stress (3 h at 37�C). The HSP90.1 and ROF1 interaction was detected in the nucleus as well as the cytoplasm rof1-hsp90_1-3 2 5 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role ancillary ancillary 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4 HsfA2 interacts with AtHSP90.1 in the BiFC system and determines the localization of the ROF1�AtHSP90.1 interaction. hsfa2-hsp90_1-4 2 6 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4 HsfA2 interacts with AtHSP90.1 in the BiFC system and determines the localization of the ROF1�AtHSP90.1 interaction.