MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A proposed reaction mechanism for rice NADPH thioredoxin reductase C, an enzyme with protein disulfide reductase activity. A proposed reaction mechanism for rice NADPH thioredoxin reductase C, an enzyme with protein disulfide reductase activity. FEBS Lett. (0014-5793) 2009 Pérez-Ruiz JM., Cejudo FJ. suggested by aryamontri in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Pérez-Ruiz JM., Cejudo FJ. suggested by aryamontri FEBS Lett. (0014-5793) 2009 A proposed reaction mechanism for rice NADPH thioredoxin reductase C, an enzyme with protein disulfide reductase activity. A proposed reaction mechanism for rice NADPH thioredoxin reductase C, an enzyme with protein disulfide reductase activity. FEBS Lett. (0014-5793) 2009 Pérez-Ruiz JM., Cejudo FJ. suggested by aryamontri in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pérez-Ruiz JM., Cejudo FJ. suggested by aryamontri FEBS Lett. (0014-5793) 2009 bas1_orysj 2-Cys peroxiredoxin BAS1, chloroplastic BAS1 Thiol-specific antioxidant protein Thioredoxin-dependent peroxiredoxin BAS1 OSJNBa0014M17.2 OsJ_07037 P0508B05.23 LOC_Os02g33450 Os02g0537700 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAACCSSLATAVSSSSAKPLAGIPPAAPHSLSLPRAPAARPLRLSASSSRSARASSFVARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI mint 5F0CA432FDA0007B ntrc_orysj Thioredoxin reductase NTRC NADPH-dependent thioredoxin reductase C OsJ_25429 LOC_Os07g46410 Os07g0657900 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAVTRLAVAAALSAAPPSSRRRRAFFHHSCRPLPSSAAAAAKALRASAAPAVDEEAPASPPPSDLGKGVENLVIIGSGPAGYTAAIYAARANLKPVVFEGYQVGGVPGGQLMTTTEVENFPGFPDGVTGPDLMDKMRKQAERWGAELHQEDVEFVNVKSRPFVIRSSDREVKCHSVIIATGAAAKRLRLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKYARHVHLLVRKDQLRASKAMQDRVLNNPNITVHFNTEAVDVVSNPKGQMSGIQLKRTDTGEESVLEVKGLFYGIGHTPNSQLLQGQIDLDDAGYILVEEGTAKTSVDGVFAAGDVQDHEWRQAVTAAGSGCVAALSVERYLVANDLLVEFHQPVREEKEKEITDRDVEMGFDISHTKHRGQYALRKVYHESPRLVCVLYTSPTCGPCRTLKPILSKVIDEYNEHVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMLRTVSGVKMKKEYREFIESNK DIP protein Q70G58 original sequence version: 75 mint C10BF4681B135DA3 bas1-ntrc 1 NTRC 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified 2cys Prx 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F2 mint bas1-ntrc-1 1 2cys Prx 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:03:16 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Cys61Ser NTRC 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:03:19 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Cys377Ser direct interaction direct interaction F3 mint bas1-bas1-1 2 2cys Prx 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified 2cys Prx 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F1 mint