MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy. The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy. EMBO J. (0261-4189) 2009 imex curation Satoo K., Noda NN., Kumeta H., Fujioka Y., Mizushima N., Ohsumi Y., Inagaki F. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Satoo K., Noda NN., Kumeta H., Fujioka Y., Mizushima N., Ohsumi Y., Inagaki F. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy. The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy. EMBO J. (0261-4189) 2009 imex curation Satoo K., Noda NN., Kumeta H., Fujioka Y., Mizushima N., Ohsumi Y., Inagaki F. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Satoo K., Noda NN., Kumeta H., Fujioka Y., Mizushima N., Ohsumi Y., Inagaki F. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy. The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy. EMBO J. (0261-4189) 2009 imex curation Satoo K., Noda NN., Kumeta H., Fujioka Y., Mizushima N., Ohsumi Y., Inagaki F. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Satoo K., Noda NN., Kumeta H., Fujioka Y., Mizushima N., Ohsumi Y., Inagaki F. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation atg4b_human Cysteine protease ATG4B Autophagy-related protein 4 homolog B Autophagin-1 Autophagy-related cysteine endopeptidase 1 AUT-like 1 cysteine endopeptidase ATG4B APG4B AUTL1 KIAA0943 protein protein human Homo sapiens Human MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL F4ADB3192176E0E5 mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F atg4b-map1lc3b 3 LC3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HsATG4B 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint f1 t1 atg4b-map1lc3b-1 1 HsATG4B 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified LC3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cleavage cleavage reaction cleavage f2a homomint mint atg4b-map1lc3b-2 2 HsATG4B 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain LC3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cleavage cleavage reaction cleavage f2a homomint mint