MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Beta2-chimaerin binds to EphA receptors and regulates cell migration. Beta2-chimaerin binds to EphA receptors and regulates cell migration. FEBS Lett. (0014-5793) 2009 Takeuchi S., Yamaki N., Iwasato T., Negishi M., Katoh H. suggested by aryamontri human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Takeuchi S., Yamaki N., Iwasato T., Negishi M., Katoh H. suggested by aryamontri FEBS Lett. (0014-5793) 2009 Beta2-chimaerin binds to EphA receptors and regulates cell migration. Beta2-chimaerin binds to EphA receptors and regulates cell migration. FEBS Lett. (0014-5793) 2009 Takeuchi S., Yamaki N., Iwasato T., Negishi M., Katoh H. suggested by aryamontri chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takeuchi S., Yamaki N., Iwasato T., Negishi M., Katoh H. suggested by aryamontri FEBS Lett. (0014-5793) 2009 p52757-1 Beta-chimaerin CHN2 ARHGAP3 BCH Beta-chimerin Rho GTPase-activating protein 3 protein protein human Homo sapiens Human MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF mint 63254958E0B5804C rac1_mouse Ras-related C3 botulinum toxin substrate 1 Rac1 p21-Rac1 protein protein mouse Mus musculus Mouse MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63001 original sequence version: 125 ACEDF83A45E5EA67 efna4_mouse Ephrin-A4 Efna4 Epl4 Eplg4 Lerk4 EPH-related receptor tyrosine kinase ligand 4 protein protein mouse Mus musculus Mouse MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGWRGGHAPSPLCLLLLLLLPILRLLRVL mint 43501971DD1C6EA5 efna2_human Ephrin-A2 EFNA2 EPLG6 LERK6 EPH-related receptor tyrosine kinase ligand 6 HEK7 ligand protein protein human Homo sapiens Human MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS DIP protein O43921 original sequence version: 73 mint 33C9FB1A8168B2D0 q80xd1-1 Beta-chimaerin Arhgap3 Chn2 Bch Beta-chimerin Rho GTPase-activating protein 3 protein protein mouse Mus musculus Mouse MCSQELWLENERKCAMVRKSKPSRKRQELLAIAFGVKVGLKGGFLWSPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF mint 164E8E735053E744 epha1_mouse Ephrin type-A receptor 1 Embryonic stem cell kinase Epha1 Esk Tyrosine-protein kinase receptor ESK protein protein mouse Mus musculus Mouse MERRWPLGLALLLLLLCAPLPPGARAEEVTLMDTSTAQGELGWLLDPPETGWSEVQQMLNGTPLYMYQDCPIQEGGDTDHWLRSNWIYRGEEASRIYVELQFTVRDCKSFPGGAGPLGCKETFNLFYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSVKLNVERCSLGHLTRRGLYLAFHNPGSCVALVSVRVFYQRCAETVHGLAHFPDTLPGPGGLVEVAGTCLSHAQISLGSSGTPRMHCSPDGEWLVPVGQCQCEPGYEESSGNVGCTACPTGFYRVDMNTLRCLKCPQHSIAESEGSTICTCENGHYRAPGEGPQVACTRPPSAPQNLSFSTSGTQLSLRWEPPRDTGGRHDIRYSVECLQCRGIAQDGGPCQPCGKGVHFSPAASGLTTSTVQVQGLEPYANYTFTVKSQNRVSGLDSSSPSSASLSINMGHAESLSGLSLKLVKKEPRQLELTWAGSRPRNPGGNLSYELHVLNQDEEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPPVSRSLTGGEIVAVIFGLLLGIALLIGIYVFRSRRGQRQRQQRQRERTTNVDREDKLWLKPYVDLQAYEDPAQGALDFAQELDPAWLIVDTVIGEGEFGEVYRGALRLPSQDCKTVAIKTLKDTSPDGYWWNFLREATIMGQFNHPHILRLEGVITKRKPIMIITEFMENGALDAFLKEREDQLAPGQLVAMLLGIASGMNCLSGHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFLQLQAHLEQLLTDPHSLRTIANFDPRVTLRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFRSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGFKD mint AB78D6E6C8B2E7F4 q80xd1-2 Beta-chimaerin Beta-chimerin Rho GTPase-activating protein 3 Chn2 Arhgap3 Bch protein protein mouse Mus musculus Mouse MALQCRISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF mint C53D6D40291F4EF0 epha1-chn2 1 Chimaerin beta 1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EphA1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EphA4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association F1A mint epha1-chn2-1 1 EphA4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Wed Jul 06 17:44:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 614-986 [EBI-8603164]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 614-614, sequence length 206 [EBI-8603164]614-986 Chimaerin beta 2 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EphA1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association mint F1A F1E F2B epha1-chn2-2 1 Chimaerin beta 2 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level EphA2 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level EphA1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association F1C homomint mint chn2-efna2 1 EphA2 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Chimaerin beta 2 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B homomint mint chn2-efna4 1 EphA4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Chimaerin beta 2 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint chn2-efna4-1 1 Chimaerin beta 1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EphA4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint chn2-rac1-2 2 Chimaerin beta 2 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rac1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3 homomint mint