IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Arabidopsis thaliana F-box protein FBL17 is essential for progression through the second mitosis during pollen development. The Arabidopsis thaliana F-box protein FBL17 is essential for progression through the second mitosis during pollen development. PLoS ONE 2009 imex curation Gusti A., Baumberger N., Nowack M., Pusch S., Eisler H., Potuschak T., De Veylder L., Schnittger A., Genschik P. Constructs expressing tagged proteins were transformed into Nicotiana benthamiana leaves using Agrobacterium tumifaciens. pascal.genschik@ibmp-ulp.u-strasbg.fr 21-Dec-2010: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gusti A., Baumberger N., Nowack M., Pusch S., Eisler H., Potuschak T., De Veylder L., Schnittger A., Genschik P. Constructs expressing tagged proteins were transformed into Nicotiana benthamiana leaves using Agrobacterium tumifaciens. pascal.genschik@ibmp-ulp.u-strasbg.fr Accepted 2009-MAY-15 by ORCHARD. PLoS ONE 2009 orchard Only protein-protein interactions imex curation The Arabidopsis thaliana F-box protein FBL17 is essential for progression through the second mitosis during pollen development. The Arabidopsis thaliana F-box protein FBL17 is essential for progression through the second mitosis during pollen development. PLoS ONE 2009 imex curation Gusti A., Baumberger N., Nowack M., Pusch S., Eisler H., Potuschak T., De Veylder L., Schnittger A., Genschik P. Constructs expressing tagged proteins were transformed into Nicotiana benthamiana leaves using Agrobacterium tumifaciens. pascal.genschik@ibmp-ulp.u-strasbg.fr 21-Dec-2010: Contacted by JYOTI. orchard Only protein-protein interactions nical Nicotiana alata (Winged tobacco) Persian tobacco bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Gusti A., Baumberger N., Nowack M., Pusch S., Eisler H., Potuschak T., De Veylder L., Schnittger A., Genschik P. Constructs expressing tagged proteins were transformed into Nicotiana benthamiana leaves using Agrobacterium tumifaciens. pascal.genschik@ibmp-ulp.u-strasbg.fr Accepted 2009-MAY-15 by ORCHARD. 21-Dec-2010: Contacted by JYOTI. PLoS ONE 2009 orchard Only protein-protein interactions imex curation ask13_arath SKP1-like protein 13 ASK13 At3g60010 F24G16.280 T2O9.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE DIP protein Q9M1X5 original sequence version: 75 FF771FCF3B9844A5 ask11_arath SKP1-like protein 11 ASK11 At4g34210 F10M10.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE DIP protein O49484 original sequence version: 96 95D23CC17C1523B0 ask10_arath SKP1-like protein 10 At3g21860 ASK10 MSD21.23 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIILKSSDGHSFEVEEEAACQCQTIAHMSEDDCTDNGIPLPEVTGKILEMVIEYCNKHHVDAANPCSDEDLKKWDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMIKDNTVEHTRKFFNIENDYTHEEEEAVRRENQWGFE 77AFFBAD7232A0AE krp7_arath Cyclin-dependent kinase inhibitor 7 KRP7 ICK5 F14J22.14 At1g49620 KIP-related protein 7 Inhibitor/interactor of CDK protein 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSETKPKRDSEYEGSNIKRMRLDDDDDVLRSPTRTLSSSSSSSLAYSVSDSGGFCSVALSEEEDDHLSSSISSGCSSSETNEIATRLPFSDLEAHEISETEISTLLTNNFRKQGISSSENLGETAEMDSATTEMRDQRKTEKKKKMEKSPTQAELDDFFSAAERYEQKRFTEKYNYDIVNDTPLEGRYQWVSLKP DIP protein Q94CL9 original sequence version: 62 6A7E0867B752E5FF ask18_arath SKP1-like protein 18 At1g10230 F14N23.11 ASK18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKILLTSSDGESFEIDEAVARKFLIIVHMMEDNCAGEAIPLENVTGDILSKIIEYAKMHVNEPSEEDEDEEAKKNLDSWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYIKDKTPEEVREIFNIENDFTPEEEEEIRKENAWTFNE 5DF3C1D971B73981 fbl17_arath F-box/LRR-repeat protein 17 F-box-like protein 17 FBL17 T5N23.10 At3g54650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQPQPHISPNTATAAISAALESQRSRKNRGSYNCGRCGQPKKGHVCLLTAPPDIPTTPIASEPVSCISAAASSSRSTVLSLTAAPSSRQTFTHLRRALSFDDVDARNSLDESDLDAASMDLDLQLDTDIVQPGRFHAVGLWEVLKRLPPSSLLMAARVCKGWRETSRKMWKAAEELRIRVPERAQIGYIGSLLQKCPRLIRLSLKIESDFDATTLACIAFSCPNLEVLEITTSGAAVNRISGDELSRFVANKRGLTSLKMEGCSNLGGFSLSSSSLSTLWLSDLHSLSKMIFNCPNLTEISLEFSRQEDDSTDLVTMVDGLGRTCTRLQNIHIASLKLSHTVVLSLTAVNFRYLRMLSLVLGINITDASVAAISSGYKNLELLDLSGSSITDTGLGMICDVLPDTLSKLLVALCPNITSSGIQFATAQLPLLELMDCGMTVSDPNSDNPTFVENPSPHKTPGYNQKMFIKHKRLKKLSLWGCSSLDALFLNCPELMDLNLNLCSNLHPESLVLQCPKLQLVYASGCQGLLTGAIRKQVSENFSAGENHMPRKRLADASKRIQALPSLYQETREDGIYAGKRRKLEKEMCTIIH DIP protein Q8W104 original sequence version: 79 B7C9668303455BB3 ask3_arath SKP1-like protein 3 ASK3 At2g25700 F3N11.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE 8F7C7796CE5CEB4F fbl17-ask11 1 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Figure 4A In contrast, ASK11 displayed a robust interaction with FBL17 in both fusions ask11-fbl17 1 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Figure 4A In contrast, ASK11 displayed a robust interaction with FBL17 in both fusions fbl17-ask3 1 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 4A fbl17-ask18 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Figure 4A fbl17-ask10 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 4A fbl17-krp7-4 2 6 unspecified role unspecified role neutral component neutral component region C-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region N-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4H to Figure 4K we observed weak but distinct nuclear interaction when FBL17 and KRP7 were co-injected. fbl17-ask13 1 8 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 4A