MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of the archaeal Kae1/Bud32 fusion protein MJ1130: a model for the eukaryotic EKC/KEOPS subcomplex. Structure of the archaeal Kae1/Bud32 fusion protein MJ1130: a model for the eukaryotic EKC/KEOPS subcomplex. EMBO J. (0261-4189) 2008 imex curation Hecker A., Lopreiato R., Graille M., Collinet B., Forterre P., Libri D., van Tilbeurgh H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hecker A., Lopreiato R., Graille M., Collinet B., Forterre P., Libri D., van Tilbeurgh H. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Structure of the archaeal Kae1/Bud32 fusion protein MJ1130: a model for the eukaryotic EKC/KEOPS subcomplex. Structure of the archaeal Kae1/Bud32 fusion protein MJ1130: a model for the eukaryotic EKC/KEOPS subcomplex. EMBO J. (0261-4189) 2008 imex curation Hecker A., Lopreiato R., Graille M., Collinet B., Forterre P., Libri D., van Tilbeurgh H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hecker A., Lopreiato R., Graille M., Collinet B., Forterre P., Libri D., van Tilbeurgh H. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Structure of the archaeal Kae1/Bud32 fusion protein MJ1130: a model for the eukaryotic EKC/KEOPS subcomplex. Structure of the archaeal Kae1/Bud32 fusion protein MJ1130: a model for the eukaryotic EKC/KEOPS subcomplex. EMBO J. (0261-4189) 2008 imex curation Hecker A., Lopreiato R., Graille M., Collinet B., Forterre P., Libri D., van Tilbeurgh H. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hecker A., Lopreiato R., Graille M., Collinet B., Forterre P., Libri D., van Tilbeurgh H. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation kae1_yeast tRNA N6-adenosine threonylcarbamoyltransferase KAE1 t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1 Kinase-associated endopeptidase 1 tRNA threonylcarbamoyladenosine biosynthesis protein KAE1 YKR038C N6-L-threonylcarbamoyladenine synthase protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKHPLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGFLPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGYNIEQLAKKAPHKENLVELPYTVKGMDLSMSGILASIDLLAKDLFKGNKKNKILFDKTTGEQKVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRANGQVHATDNRFCIDNGVMIAQAGLLEYRMGGIVKDFSETVVTQKFRTDEVYAAWRD 76A73F2E9E26CF4C 76A73F2E9E26CF4C bud32_yeast EKC/KEOPS complex subunit BUD32 YGR262C BUD32 LDB14 piD261 Low-dye-binding protein 14 Atypical serine/threonine protein kinase BUD32 Bud site selection protein 32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFSNLKNFLWMHDQDPYSDLVATTLRKVGRQIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLYVLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEVRLRGRKRSMLG D12E97BAE21B3385 D12E97BAE21B3385 glrx4_yeast Monothiol glutaredoxin-4 GRX4 SYGP-ORF64 YER174C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAKGPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGILREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQHALQ 86B4C4993545B5B2 86B4C4993545B5B2 kae1-bud32-3 2 KAE1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level P36132:p.Glu292Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Tue Jul 12 10:12:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:28:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu292arg' Tue Jun 30 18:46:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu292Arg' P36132:p.Glu295Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Tue Jul 12 10:12:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:45:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu295arg' Tue Jun 30 20:04:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu295Arg' tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BUD32 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a homomint mint kae1-bud32-4 2 KAE1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level P36132:p.Glu295Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Tue Jul 12 10:11:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:31:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu295arg' Tue Jun 30 19:39:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu295Arg' tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BUD32 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a homomint mint kae1-bud32-5 2 BUD32 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined KAE1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36132:p.Glu292Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R Tue Jul 12 10:52:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:47:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu292arg' Tue Jun 30 18:47:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu292Arg' physical association physical association f5a homomint mint bud32-kae1-4 1 KAE1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified BUD32 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P53323:p.Lys57Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:12:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:31:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys57glu' Tue Jun 30 18:14:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' direct interaction direct interaction f6 homomint mint bud32-kae1-5 1 KAE1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified BUD32 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P53323:p.Tyr59Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y E Tue Jul 12 10:12:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:20:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr59glu' Tue Jun 30 18:59:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr59Glu' direct interaction direct interaction f6 homomint mint bud32-kae1-6 1 KAE1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified BUD32 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P53323:p.Arg60Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:18:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:37:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg60glu' Tue Jun 30 18:06:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg60Glu' direct interaction direct interaction f6 homomint mint bud32-kae1-7 1 BUD32 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P53323:p.Arg72Glu mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Jul 12 10:19:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:47:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg72glu' Tue Jun 30 18:08:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Glu' KAE1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f6 homomint mint bud32-kae1-8 1 BUD32 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified KAE1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P36132:p.Asp236Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D R Tue Jul 12 10:19:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:23:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp236arg' Tue Jun 30 19:14:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp236Arg' direct interaction direct interaction f6 homomint mint bud32-kae1-9 1 BUD32 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified KAE1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:43:55 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Asp292Arg direct interaction direct interaction f6 homomint mint bud32-grx4-10 3 GRX4 6 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified BUD32 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53323:p.Asp161Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:56:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:22:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp161ala' Tue Jun 30 19:13:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp161Ala' phosphorylation phosphorylation reaction phosphorylation f2 homomint mint