MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it RNA pol II subunit RPB7 is required for RNA pol I-mediated transcription in Trypanosoma brucei. RNA pol II subunit RPB7 is required for RNA pol I-mediated transcription in Trypanosoma brucei. EMBO Rep. (1469-221X) 2009 imex curation Peñate X., López-Farfán D., Landeira D., Wentland A., Vidal I., Navarro M. 2009-03-19 Only protein-protein interactions tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Peñate X., López-Farfán D., Landeira D., Wentland A., Vidal I., Navarro M. EMBO Rep. (1469-221X) 2009 2009-03-19 Only protein-protein interactions imex curation RNA pol II subunit RPB7 is required for RNA pol I-mediated transcription in Trypanosoma brucei. RNA pol II subunit RPB7 is required for RNA pol I-mediated transcription in Trypanosoma brucei. EMBO Rep. (1469-221X) 2009 imex curation Peñate X., López-Farfán D., Landeira D., Wentland A., Vidal I., Navarro M. 2009-03-19 Only protein-protein interactions tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Peñate X., López-Farfán D., Landeira D., Wentland A., Vidal I., Navarro M. EMBO Rep. (1469-221X) 2009 2009-03-19 Only protein-protein interactions imex curation RNA pol II subunit RPB7 is required for RNA pol I-mediated transcription in Trypanosoma brucei. RNA pol II subunit RPB7 is required for RNA pol I-mediated transcription in Trypanosoma brucei. EMBO Rep. (1469-221X) 2009 imex curation Peñate X., López-Farfán D., Landeira D., Wentland A., Vidal I., Navarro M. 2009-03-19 Only protein-protein interactions tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Peñate X., López-Farfán D., Landeira D., Wentland A., Vidal I., Navarro M. EMBO Rep. (1469-221X) 2009 2009-03-19 Only protein-protein interactions imex curation q387n1_tryb2 Tb11.03.0935 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MIQSDIVSYVGEMGDVPDALLITPLKDRKSSVYLTKYEVARIIGERARQIVNGTSVLLDSQNGCGTGNSLELAEGCADPFAASVDPIHITKLELLQGRIPMIVRRTWPDGRTENIPVNELKVDKMLLDVQH mint CF08D86F4EEE0B44 q381y8_tryb2 Tb11.01.6090 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MFYKMKLERNIKVEPHLLERTLHRHLEEYLRKAVEGTPLHLSLGNALRSGLARTNQNSSAVIIAVLDILNTSSLEGRVLDDGSVSFFVKYEGLVFKLHRGEVIDVIVSSVEREGWWGDVMGVGRMYISRGQMGNEWVYESDGMRGIWITKDGARSVKEGEIVRVRVVAETPQSEGVLAVGSMVGNYLGPL mint B187E9D2FAABF45C rpa1_trybb DNA-directed RNA polymerase I subunit RPA1 TRP11 DNA-directed RNA polymerase I largest subunit protein protein trybb Trypanosoma brucei brucei MSGIAFVEVRTRAGQEDRSAPWRPVVRNGENHATFYDTRMGNFDANPFPPQTCQTCAASLTGKYGNERCHGHFGFVGMPRIRPGSAHSDSDRLVVLNPHLAMDADRLFRAKCFFCHKFRAPTFDVERFRQALVLADHGLPGDALHLLDTVPTAKGHDAMLNHRRMANEEIVNDVSILQSYVDRILRQRASGCSEEDAKARVTMAQKGTVDVRNDICNMAISHLRSFSGPCSHCTAISPTFLKRGGIIFFLFRKSNLVTNIAKGFLTQQEVSEWEAVNRLHGRTGTYFDGRQMLFHMKNLFAKEQAILGLLYPNLGEPSVFTKTNKVVPASERYKLFFLDRILVPPLPLRLSSGVRVNDNGLIIPDEQTRALSDILGFVEQIECFHTLSANSTNGRSFITDAQRAVNESNLRNLQQKVDEFYAEIVNSFAKKEGLFRMNMMGKRVNQACRSVISPDPFVEPNEVLLPRPLARALSFPEQVTCFAPARMNLLKHCVVNGPRKYPGATHIELRHANGEIRSVDLNVPEQTRRQHAARFFAMAQSGVTLIVYRHILNGDRVIFNRQPTLHKPSMMGYRVKVLSGSKTIRFHYVNGNSFNADFDGDEMNVHVPQSIETRAEVETLMDANINYLVPTSGRPIRGLIQDHVAAGVLVTLRDKFFDHSTFVQLVYNGVGPYIQENVGITLAELIPIPAILMPRPMWTGKQLISVMVRFSSGLSAASDCGREIEGGITLKGTSQIQPSAFDRIPAGSCDAVRAKSGAVVDSTVMFANSELITGFMCKKQLGASNMSAPHHVYELYGPHRTGQLFAAFGRVLLLALRKEGLSLAMDDMFLVDEERRCDLLRKLDDIALDVPDEEATAAPMIADYATKIQQEFVPQRMLVPFPKNHLLLMTISGAKGSNLNATQMSLQLGQQLFDGLRVKRMNSSKTLPSFFTNEKRARSFGFAMGSFASGIRPAEYTIHAMAGRDGLIDTAVKTSRSGHLQRCLIKGLESLVVHWDRTVRDSNGSVIQFMYGGDGLDPCKASTLTAWEMMKDNVVDVSKRFGGDASESVAGAEDGAAAGLKEMRNEDGKPTTEAVQNAHMEQQLSTYPLPASLDKSLSEYLCKKADFPLFRKVSTLARWDAKQQLKERLQQRRQKWVGAFEKTLADITARRRLWALCEPGEPVGLLAAQAAGEPSTQMTLNTFHTAGSTVSHVTEGIPRLRELLIYASVNKAAVVVPVTNATEEDEKVIAKMLRAGVAAKLTDCLAKVTDGAGGQSASSSMQRNLNTGFGKGYHYHVARGRTGMVITVSFLFSRSCLEELRKRMCMSPSEHRQSFTEALKNVVRLIMRSLSAVPREKESGDGSGNTGGMKGGSGRADRKRKRSGPDDGGGPLGGTFGDEIMRIEEGTDSDDGMSERSSIGGGRAGSEVSSLHSDGTDTRGIAGSDTGGPQRRRGSVESGRGDDASDSEAADPDLYARRSGSPARDAEDGGEMQDRDGTDWGGTSMQGVVGYDNFPEIHMSFTKSNFGAVIAPLSTAAAARDGVVQLHEDFFIVNAVLRTASDVIAVIPDVVDNALEAQRMPSWLPQFGSLTFTRLKDKGSGQLVFQGPGSTMRNVMSFLSLFTVGIKSIKLHQACSTDIRDMGTYFGIESGYAALYDELNKLFNRYNVDPRHLSLIADTSTHRGRWENFNFTGVISTSASPLFQMTFASSKRWLHRAVSRGMSDDLESFSSAIMVGERPRVGTASVRLSTDTAILRDVLERNFA mint 5D1D2C6C7B89229F q387n1-q381y8 3 TbRPB7 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level rpa1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level TbRPB6z 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association F3A mint q381y8-q387n1 2 TbRPB6z 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TbRPB7 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3B mint trp11-q381y8 2 TbRPB7 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level rpa1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C mint q381y8-trp11 2 rpa1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level TbRPB7 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3C mint q381y8-trp11-1 1 rpa1 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell TbRPB7 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4 mint