MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The SH3 domain of alphaII spectrin is a target for the Fanconi anemia protein, FANCG. The SH3 domain of alphaII spectrin is a target for the Fanconi anemia protein, FANCG. Biochemistry (0006-2960) 2009 mimix curation Lefferts JA., Wang C., Sridharan D., Baralt M., Lambert MW. FancG\'s taxid has not been specified suggested by mcarducci mimix curation human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lefferts JA., Wang C., Sridharan D., Baralt M., Lambert MW. FancG\'s taxid has not been specified suggested by mcarducci Biochemistry (0006-2960) 2009 mimix curation mimix curation The SH3 domain of alphaII spectrin is a target for the Fanconi anemia protein, FANCG. The SH3 domain of alphaII spectrin is a target for the Fanconi anemia protein, FANCG. Biochemistry (0006-2960) 2009 mimix curation Lefferts JA., Wang C., Sridharan D., Baralt M., Lambert MW. FancG\'s taxid has not been specified suggested by mcarducci mimix curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lefferts JA., Wang C., Sridharan D., Baralt M., Lambert MW. FancG\'s taxid has not been specified FancG\'s taxid has not been specified suggested by mcarducci Biochemistry (0006-2960) 2009 mimix curation mimix curation sptn1_human Spectrin alpha chain, non-erythrocytic 1 SPTAN1 SPTA2 Alpha-II spectrin Fodrin alpha chain NEAS Spectrin, non-erythroid alpha subunit protein protein human Homo sapiens Human MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 4433BF74EFCEFC8A fancf_human Fanconi anemia group F protein FANCF protein protein human Homo sapiens Human MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV 1F295CD1FBE6ED7D fancc_human Fanconi anemia group C protein FANCC FAC FACC protein protein human Homo sapiens Human MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSSLPQAACHPAIFRVVDEMFRCALLETDGALEIIATIQVFTQCFVEALEKASKQLRFALKTYFPYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPRSEKLARELLKELRTQV DIP protein Q00597 original sequence version: 110 C9DDFFAC725D050C fancg_human Fanconi anemia group G protein FANCG XRCC9 DNA repair protein XRCC9 protein protein human Homo sapiens Human MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAELESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTGRAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEELLSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCLELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLSVQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWIRPSDRDAFLEEFRTSLPKSCDL 4BC7475472AC3C84 fancg-sptan1 2 FANCG 6 unspecified role unspecified role bait bait alpha 2 Sp 3 unspecified role unspecified role prey prey Q13813:p.Glu985Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:08:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:15:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu985ala' Tue Jun 30 18:16:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu985Ala' Q13813:p.Trp1005Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W S Tue Jul 12 10:08:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:01:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1005ser' Tue Jun 30 15:55:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1005Ser' Q13813:p.Trp1004Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W S Tue Jul 12 10:50:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:48:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1004ser' Tue Jun 30 18:47:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1004Ser' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint f1b f1c f2b f2c f3b fancg-sptan1-1 2 FANCG 6 unspecified role unspecified role bait bait O15287:p.Pro391Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:08:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:04:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro391ala' Tue Jun 30 17:42:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro391Ala' O15287:p.Pro385Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:50:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:23:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro385ala' Tue Jun 30 19:42:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro385Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O15287:p.Pro394Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:08:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:41:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro394ala' Tue Jun 30 18:28:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro394Ala' O15287:p.Pro386Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:42:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro386ala' Tue Jun 30 18:12:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro386Ala' alpha 2 Sp 3 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f4b f4c homomint mint fancg-sptan1-2 2 alpha 2 Sp 3 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FANCG 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f4b f4c homomint mint fancg-fancg 2 FANCG 6 unspecified role unspecified role bait bait FANCG 6 unspecified role unspecified role prey prey O15287:p.Pro394Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:31:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro394ala' Tue Jun 30 20:22:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro394Ala' O15287:p.Pro385Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:07:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:41:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro385ala' Tue Jun 30 18:53:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro385Ala' O15287:p.Pro391Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:50:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:47:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro391ala' Tue Jun 30 17:43:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro391Ala' O15287:p.Pro386Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:06:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:19:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro386ala' Tue Jun 30 17:28:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro386Ala' physical association physical association homomint mint f5a f5b sptan1-fancg 1 alpha 2 Sp 3 unspecified role unspecified role bait bait FANCG 6 unspecified role unspecified role prey prey physical association physical association homomint mint f6a f6b sptan1-fancc-1 1 alpha 2 Sp 3 unspecified role unspecified role bait bait FANCC 5 unspecified role unspecified role prey prey physical association physical association homomint mint f6a f6b sptan1-fancf 1 FANCF 4 unspecified role unspecified role prey prey alpha 2 Sp 3 unspecified role unspecified role bait bait physical association physical association homomint mint f6a f6b