MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. EMBO J. (0261-4189) 2008 imex curation Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. EMBO J. (0261-4189) 2008 imex curation Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. EMBO J. (0261-4189) 2008 imex curation Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse. EMBO J. (0261-4189) 2008 imex curation Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Jin N., Chow CY., Liu L., Zolov SN., Bronson R., Davisson M., Petersen JL., Zhang Y., Park S., Duex JE., Goldowitz D., Meisler MH., Weisman LS. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation vac14_human Protein VAC14 homolog Tax1-binding protein 2 VAC14 TAX1BP2 TRX protein protein human Homo sapiens Human MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEFALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNIVKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVSFIPLLRERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVLGEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGILTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDELDELRPGQRQAEPTPDDALPKQEGTASGGPDGSCDSSFSSGISVFTAASTERAPVTLHLDGIVQVLNCHLSDTAIGMMTRIAVLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTDDPGPLDGPDLQASHSELQVPTPGRAGLLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFSSERKLLEVRGPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHALNTILLTSTELFQLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVDFLAEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL B39AC1F4D619570F fig4_yeast Polyphosphoinositide phosphatase YNL325C N0330 FIG4 Phosphatidylinositol 3,5-bisphosphate 5-phosphatase Factor-induced gene 4 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNDAMEHTLGGGILTTSGSKQRKTSKFVMGKYTLYETKDRMYIVGSNKRETMFRILEIDLTVPRGELTVLEDNVFFTRNEIMNVLASLEEATEDGLHKKITGYGLLGFIKFTCWYYLIMVTKYSQVAVIGGHGIYHIDGIDIIPITNNYKKPEKSSDEARLLNIFKDLDLTKTFYFSYTYDITNTLQTNILREKLKAVDRCDITIPCGITDYNEMFVWNNNLLSPIFACIDTVFDWFQCIIHGFIDQVNVSVLGKSIYITLIARRSHHFAGARFLKRGVNNKGHVANEVETEQIVTDMILTPFHQPGNGFFDSDRYTSFVQHRGSIPLYWTQDASNLTTKPPIRINVVDPFFSPAALHFDNLFQRYGGGTIQILNLIKTKEKTPRETKLLWEFEQCIDYLNEFLPTLKKLDYTSWDMSRASKQDGQGVIEFLEKYAVNTVTTTGIFHNGPDFASTKIQEGICRSNCIDCLDRTNAAQFVIGKRALGCQLKSLGIIDNSYLEYDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWSSHSRDMIESIKRFYSNSFVDAQRQDAINLFLGHYSWREGFPSLWEMNTDFYLHNAYSLNMPKRSYIHWWNDYNIKSVKELINEELIATGNDVTREKIIKNVRGYPGAFDNYWNEYYLPRSVTWIRDLFAYNMNSTRRYHNALSKQDKAMSPFTSRKQSWLNNKLKMITSSKSLEKAEGRVVETTDLDRDTSPKQELELYEHYLHIISDRSQKLEEKMNSFSYSKYPIFISHESSEIPPMRKVIGEPLVDIAEDFTDVYDDDDDGDDENDEMTTEALLIAPDHVSVDEKFYEKVLNVDDYKPALDDYSAVIHIKPDNLQLYRDLCFSKDIQLDFQ 872B3231104185FA fig4_human Polyphosphoinositide phosphatase FIG4 KIAA0274 SAC3 Phosphatidylinositol 3,5-bisphosphate 5-phosphatase SAC domain-containing protein 3 Serine-protein phosphatase FIG4 protein protein human Homo sapiens Human MPTAAAPIISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKDLVIIDDRHVYTQQEVRELLGRLDLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKVEDTNMIYIPNDSVRVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELLDIIKSTVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALHFDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPHLWELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYREYIRNRYL 7B6F115C095EC332 fyv1_human 1-phosphatidylinositol 3-phosphate 5-kinase PIKFYVE KIAA0981 PIP5K3 FYVE finger-containing phosphoinositide kinase PIKfyve Phosphatidylinositol 3-phosphate 5-kinase type III Serine-protein kinase PIKFYVE protein protein human Homo sapiens Human MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEGAVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHSTTACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQDDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDYFAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSDAVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLERYCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEYRNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQKKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC 390C43530D3B1E81 vac7_yeast Vacuolar segregation protein 7 N2467 YNL2467W YNL054W VAC7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEEDRKLTVETETVEAPVANNLLLSNNSNVVAPNPSIPSASTSTSPLHREIVDDSVATANTTSNVVQHNLPTIDNNLMDSDATSHNQDHWHSDINRAGTSMSTSDIPTDLHLEHIGSVSSTNNNSNNALINHNPLSSHLSNPSSSLRNKKSSLLVASNPAFASDVELSKKKPAVISNNMPTSNIALYQTARSANIHGPSSTSASKAFRKASAFSNNTAPSTSNNIGSNTPPAPLLPLPSLSQQNKPKIIERPTMHVTNSREILLGENLLDDTKAKNAPANSTTHDNGPVANDGLRIPNHSNADDNENNNKMKKNKNINSGKNERNDDTSKICTTSTKTAPSTAPLGSTDNTQALTASVSSSNADNHNNNKKKTSSNNNGNNSNSASNKTNADIKNSNADLSASTSNNNAINDDSHESNSEKPTKADFFAARLATAVGENEISDSEETFVYESAANSTKNLIFPDSSSQQQQQQQQPPKQQQQQQNHGITSKISAPLLNNNKKLLSRLKNSRHISTGAILNNTIATISTNPNLNSNVMQNNNNLMSGHNHLDELSSIKQEPPHQLQQQQPPMDVQSVDSYTSDNPDSNVIAKSPDKRSSLVSLSKVSPHLLSSTSSNGNTISCPNVATNSQELEPNNDISTKKSLSNSTLRHSSANRNSNYGDNKRPLRTTVSKIFDSNPNGAPLRRYSGVPDHVNLEDYIEQPHNYPTMQNSVKKDEFYNSRNNKFPHGLNFYGDNNVIEEENNGDSSNVNRPQHTNLQHEFIPEDNESDENDIHSMFYYNHKNDLETKPLISDYGEDEDVDDYDRPNATFNSYYGSASNTHELPLHGRMPSRSNNDYYDFMVGNNTGNNNQLNEYTPLRMKRGQRHLSRTNNSIMNGSIHMNGNDDVTHSNINNNDIVGYSPHNFYSRKSPFVKVKNFLYLAFVISSLLMTGFILGFLLATNKELQDVDVVVMDNVISSSDELIFDITVSAFNPGFFSISVSQVDLDIFAKSSYLKCDSNGDCTVMEQERKILQITTNLSLVEESANNDISGGNIETVLLGTAKKLETPLKFQGGAFNRNYDVSVSSVKLLSPGSREAKHENDDDDDDDGDDGDDENNTNERQYKSKPNARDDKEDDTKKWKLLIKHDYELIVRGSMKYEVPFFNTQKSTAIQKDSMVHPGKK 0414978AA3066CE7 atg18_yeast Autophagy-related protein 18 NMR1 YFR021W ATG18 AUT10 CVT18 SVP1 Cytoplasm to vacuole targeting protein 18 Swollen vacuole phenotype protein 1 Needed for premeiotic replication protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSSPTINFINFNQTGTCISLGTSKGFKIFNCEPFGKFYSEDSGGYAIVEMLFSTSLLALVGIGDQPALSPRRLRIINTKKHSIICEVTFPTSILSVKMNKSRLVVLLQEQIYIYDINTMRLLHTIETNPNPRGLMAMSPSVANSYLVYPSPPKVINSEIKAHATTNNITLSVGGNTETSFKRDQQDAGHSDISDLDQYSSFTKRDDADPTSSNGGNSSIIKNGDVIVFNLETLQPTMVIEAHKGEIAAMAISFDGTLMATASDKGTIIRVFDIETGDKIYQFRRGTYATRIYSISFSEDSQYLAVTGSSKTVHIFKLGHSMSNNKLDSDDSNMEEAAADDSSLDTTSIDALSDEENPTRLAREPYVDASRKTMGRMIRYSSQKLSRRAARTLGQIFPIKVTSLLESSRHFASLKLPVETNSHVMTISSIGSPIDIDTSEYPELFETGNSASTESYHEPVMKMVPIRVVSSDGYLYNFVMDPERGGDCLILSQYSILMD 06B2DFAF842AE933 06B2DFAF842AE933 fab1_yeast 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 FAB1 YFR019W Type III PIP kinase Formation of aploid and binucleate cells protein 1 SVL7 Styryl dye vacuolar localization protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSEEPHASISFPDGSHVRSSSTGTSSVNTIDATLSRPNYIKKPSLHIMSTSTTSTTTDLVTNPILSNISVPKISPPTSSSIATATSTSHVTGTASHSNIKANANTSTSVNKKNLPPTTSGRIPSSTIKRYPSRYKPSHSLQLPIKNDSNFKRSSIYASKSTVTAIPIRNNRPISMQNSYARTPDSDHDDVGDEVSSIKSASSSLTASLSKSFLFAFYNNRKKDKTSNNGVLSKEYWMKDESSKECFSCGKTFNTFRRKHHCRICGQIFCSSCTLLIDGDRFGCHAKMRVCYNCYEHADTYEDSSDEENDSTMQLNEPRSRSRSRSSNTNPYSHSHSHLHLISQDNHNGTDLHDPVAATDNPQQQNEVYLLNDDDVQSIMTSGEDSKLFISTPPPPPKMAIPATKQGGSLEISFDSENDRALHYQDDNPGRHHHLDSVPTRYTIRDMDNISHYDTNSNSTLRPHYNTNNSTITINNLNNTTSNNSNYNNTNSNSNINNPAHSLRRSIFHYVSSNSVNKDSNNSSATPASSAQSSSILDPANRIIGNYAHRNYKFKFNYNSKGPSQQNDTANGNNDNNNNNNNNNNNNNNNSASGIADNNNIPSNDNGTTFTLDKKKRNPLTKSKSTSAYLEYPLNEEDSSEDEGSMSIYSVLNDDHKTDNPIRSMRNSTKSFQRAQASLQRMRFRRKSKSKHFPNNSKSSIYRDLNFLTNSTPNLLSVVSDDNLYDDSSPLQDKASSSAASRLTDRKFSNSSGSNNNSNSNSNINTDPWKRIASISGFKLKKEKKRELNEVSLLHMHALLKQLLNDQEISNLQEWITLLDGALRKVLRTILNARDLNTLDFRQTYVKIKRISGGSPQNSEYIDGVVFSKALPSKTMPRHLKNPRILLIMFPLEYQKNNNHFLSIESVFRQEREYLDKLVSRLKSLHPDIIYVGANVSGYALELLNDSGIVVQFNMKPQVIERIAKLTEADIAISVDKLATNIKMGECETFEVKSYIYGNISKTYTFLRGCNPELGGTILLRGDSLENLRKIKQVSEFMVYAIFSLKLESSFFNDNFIQLSTDVYLKRAESKKLQVFEGYFADFLIKFNNRILTVSPTVDFPIPFLLEKARGLEKKLIERINQYESESDLDRQTQLNMLQGLESTITKKHLGNLIKFLHEMEIENLELEFQKRSRQWEVSYSSSQNLLGTGSHQSITVLYSMVSTKTATPCVGPQIVTIDYFWDSDISIGQFIENVVGTARYPCQQGCNGLYLDHYRSYVHGSGKVDVLIEKFQTRLPKLKDIILTWSYCKKCGTSTPILQISEKTWNHSFGKYLEVMFWSYKDSVTGIGKCPHDFTKDHVKYFGYNDLVVRLEYSDLEVHELITPPRKIKWKPHIDIKLKVELYYKILEKINNFYGSVLSRLERIKLDSMTKDKVLSGQAKIIELKSNATEEQKLMLQDLDTFYADSPCDQHLPLNLVIKSLYDKAVNWNSTFAIFAKSYLPSETDISRITAKQLKKLFYDSSRKDSEDKKSLHDEKAKTRKPEKNELPLEGLKDVEKPKIDSKNTTENRDRTNEPQNAVTITTFKDDTPIIPTSGTSHLTVTPSASSVSSSLTPQTEERPPISRSGTGISMTHDKSTRPNIRKMSSDSSLCGLASLANEYSKNNKVSKLATFFDQMHFDALSKEFELERERERLQLNKDKYQAIRLQTSTPIVEIYKNVKDAVDEPLHSRSSGNNLSSANVKTLEAPVGEHSRANNCNPPNLDQNLETELENSISQWGENILNPSGKTTASTHLNSKPVVKETSENPKSIVRESDNSKSEPLPPVITTTTVNKVESTPQPEKSLLMKTLSNFWADRSAYLWKPLVYPTCPSEHIFTDSDVIIREDEPSSLIAFCLSTSDYRNKMMNLNVQQQQQQQTAEAAPAKTGGNSGGTTQTGDPSVNISPSVSTTSHNKGRDSEISSLVTTKEGLLNTPPIEGARDRTPQESQTHSQANLDTLQELEKIMTKKTATHLRYQFEEGLTVMSCKIFFTEHFDVFRKICDCQENFIQSLSRCVKWDSNGGKSGSGFLKTLDDRFIIKELSHAELEAFIKFAPSYFEYMAQAMFHDLPTTLAKVFGFYQIQVKSSISSSKSYKMDVIIMENLFYEKKTTRIFDLKGSMRNRHVEQTGKANEVLLDENMVEYIYESPIHVREYDKKLLRASVWNDTLFLAKMNVMDYSLVIGIDNEGYTLTVGIIDFIRTFTWDKKLESWVKEKGLVGGASVIKQPTVVTPRQYKKRFREAMERYILMVPDPWYREGN 1A0A30E13165DE41 vac14_yeast Vacuole morphology and inheritance protein 14 YLR386W L3502.1 Swollen vacuole phenotype 2 protein VAC14 SVP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEKSIAKGLSDKLYEKRKAAALELEKLVKQCVLEGDYDRIDKIIDELCRDYAYALHQPMARNAGLMGLAATAIALGINDVGRYLRNILPPVLACFGDQNDQVRFYACESLYNIAKIAKGEILVYFNEIFDVLCKISADTENSVRGAAELLDRLIKDIVAERASNYISIVNNGSHGLLPAIKTDPISGDVYQEEYEQDNQLAFSLPKFIPLLTERIYAINPDTRVFLVDWLKVLLNTPGLELISYLPSFLGGLFTFLGDSHKDVRTVTHTLMDSLLHEVDRISKLQTEIKMKRLERLKMLEDKYNNSSTPTKKADGALIAEKKKTLMTALGGLSKPLSMETDDTKLSNTNETDDERHLTSQEQLLDSEATSQEPLRDGEEYIPGQDINLNFPEVITVLVNNLASSEAEIQLIALHWIQVILSISPNVFIPFLSKILSVLLKLLSDSDPHITEIAQLVNGQLLSLCSSYVGKETDGKIAYGPIVNSLTLQFFDSRIDAKIACLDWLILIYHKAPNQILKHNDSMFLTLLKSLSNRDSVLIEKALSLLQSLCSDSNDNYLRQFLQDLLTLFKRDTKLVKTRANFIMRQISSRLSPERVYKVISSILDNYNDTTFVKMMIQILSTNLITSPEMSSLRNKLRTCEDGMFFNSLFKSWCPNPVSVISLCFVAENYELAYTVLQTYANYELKLNDLVQLDILIQLFESPVFTRMRLQLLEQQKHPFLHKCLFGILMIIPQSKAFETLNRRLNSLNIWTSQSYVMNNYIRQRENSNFCDSNSDISQRSVSQSKLHFQELINHFKAVSEEDEYSSDMIRLDHGANNKSLLLGSFLDGIDEDKQEIVTPISPMNEAINEEMESPNDNSSVILKDSGSLPFNRNVSDKLKK E625AB6F032D2E1B E625AB6F032D2E1B vac14-fig4-6 3 VAC14 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q08AM6:p.Leu156Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L R Tue Jul 12 10:23:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:52:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu156arg' Tue Jun 30 18:26:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu156Arg' FIG4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2b homomint mint vac14-pikfyve 3 VAC14 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q08AM6:p.Leu156Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L R Tue Jul 12 10:11:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:17:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu156arg' Tue Jun 30 18:47:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu156Arg' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Fab1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2b homomint mint vac14-fab1 3 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06708:p.Leu149Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L R Tue Jul 12 10:52:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:15:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu149arg' Tue Jun 30 18:56:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu149Arg' FAB1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint f2c f3d vac14-vac7 3 VAC7 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06708:p.Leu149Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L R Tue Jul 12 10:52:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:43:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu149arg' Tue Jun 30 17:25:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu149Arg' physical association physical association mint f2c f3d vac14-atg18 3 ATG18 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q06708:p.Leu149Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L R Tue Jul 12 10:09:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:55:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu149arg' Tue Jun 30 16:57:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu149Arg' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f2c f3d vac14-vac14-3 3 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f2c f3d vac14-fig4-7 3 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FIG4 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f2c f3d fab1-vac14-1 3 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P34756:p.Gly864Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Tue Jul 12 10:19:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:35:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly864glu' Tue Jun 30 16:45:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly864Glu' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5c homomint mint vac7-vac14 3 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06708:p.Leu329Ile mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L I Tue Jul 12 10:55:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:33:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329ile' Tue Jun 30 19:33:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu329Ile' Q06708:p.His56Tyr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Tue Jul 12 10:54:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:26:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his56tyr' Tue Jun 30 15:36:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His56Tyr' Q06708:p.Gln101Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q R Tue Jul 12 10:16:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:14:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln101arg' Tue Jun 30 18:10:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln101Arg' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06708:p.Arg61Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:54:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:35:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg61lys' Tue Jun 30 19:36:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg61Lys' VAC7 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6d mint atg18-vac14 3 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06708:p.Gln101Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q R Tue Jul 12 10:16:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:09:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln101arg' Tue Jun 30 17:04:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln101Arg' Q06708:p.His56Tyr mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Tue Jul 12 10:16:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:00:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his56tyr' Tue Jun 30 20:20:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His56Tyr' Q06708:p.Leu329Ile mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L I Tue Jul 12 10:17:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:11:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329ile' Tue Jun 30 19:56:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu329Ile' Q06708:p.Arg61Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:17:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:40:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg61lys' Tue Jun 30 19:47:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg61Lys' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ATG18 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6d homomint mint vac14-vac7-1 2 VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell VAC7 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2e mint vac14-fab1-1 2 FAB1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P34756:p.Gly864Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Tue Jul 12 10:17:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:37:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly864glu' Tue Jun 30 17:54:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly864Glu' VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5d homomint mint fig4-fab1 2 FIG4 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P34756:p.Gly864Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Tue Jul 12 10:59:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:16:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly864glu' Tue Jun 30 17:10:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly864Glu' physical association physical association homomint f5e mint fab1-vac14-2 2 VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06708:p.Leu149Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L R Tue Jul 12 10:24:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:23:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu149arg' Tue Jun 30 18:48:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu149Arg' ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4e homomint mint vac14-fig4-8 2 VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FIG4 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf7a fab1-fig4 2 FAB1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FIG4 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4d fab1-fig4-1 2 FIG4 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4e fig4-fab1-1 2 FIG4 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association homomint mint sf6b vac14-vac14-4 2 VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4a vac14-fab1-2 2 VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association homomint mint sf6a fab1-vac14-3 2 FAB1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4b fab1-vac14-4 2 FAB1 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4f vac14-fig4-9 2 VAC14 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FIG4 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4c atg18-fab1 4 VAC7 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level VAC14 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level FAB1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level FIG4 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ATG18 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization homomint f2f mint fig4-vac14-2 1 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FIG4 6 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint sf5 fab1-vac14-5 1 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FAB1 11 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint sf5 atg18-vac14-1 1 VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ATG18 10 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization homomint mint sf5 vac14-vac7-2 1 ATG18 9 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAC14 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization mint sf5