MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Regulated association of misfolded endoplasmic reticulum lumenal proteins with P58/DNAJc3. Regulated association of misfolded endoplasmic reticulum lumenal proteins with P58/DNAJc3. EMBO J. (0261-4189) 2008 imex curation Petrova K., Oyadomari S., Hendershot LM., Ron D. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Petrova K., Oyadomari S., Hendershot LM., Ron D. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Regulated association of misfolded endoplasmic reticulum lumenal proteins with P58/DNAJc3. Regulated association of misfolded endoplasmic reticulum lumenal proteins with P58/DNAJc3. EMBO J. (0261-4189) 2008 imex curation Petrova K., Oyadomari S., Hendershot LM., Ron D. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Petrova K., Oyadomari S., Hendershot LM., Ron D. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation dnjc3_mouse DnaJ homolog subfamily C member 3 Dnajc3 P58ipk Interferon-induced, double-stranded RNA-activated protein kinase inhibitor Protein kinase inhibitor of 58 kDa protein protein mouse Mus musculus Mouse MVAPGSVGSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNPFSSGGPFRFKFHFN mint May inhibit both the autophosphorylation of EIF2AK2/PKR and the ability of EIF2AK2/PKR to catalyze phosphorylation of the EIF2A. Co-chaperone of HSPA8/HSC70. Involved in the unfolded protein response (UPR) during ER stress. Regulates the activity and the autophosphorylation of EIF2AK2. Stimulates the ATPase activity of HSPA8 (By similarity). May inhibit EIF2AK3 activity during the ER stress response. Overexpression of DNAJC3 reduces EIF2AK3/PERK-mediated EIF2A phosphorylation 510C27782C6EDF66 bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL DIP protein P11021 original sequence version: 127 DIP protein P11021 original sequence version: 137 DIP protein P11021 original sequence version: 185 59B7D8D85BC32A00 rnas1_human Ribonuclease pancreatic RNASE1 RIB1 RNS1 HP-RNase RIB-1 RNase UpI-1 Ribonuclease 1 Ribonuclease A protein protein human Homo sapiens Human MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST F63B17B8B55115F9 dnajc3-hspa5 2 p58 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Bip 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2B homomint mint Human Bip Uniprot ID has been used instead of Cricetulus griseus one. rnase1-dnajc3 1 p58 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain RNase A 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association homomint domino mint RNase A taxid has not been specified. F6A dnajc3-hspa5-1 1 p58 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q91YW3:p.His422Gln mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Q Tue Jul 12 10:20:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:08:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his422gln' Tue Jun 30 18:42:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His422Gln' Bip 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P11021:p.Glu201Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E G Tue Jul 12 10:21:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:57:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu201gly' Tue Jun 30 20:15:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu201Gly' direct interaction direct interaction homomint domino mint Human Bip Uniprot ID has been used instead of Cricetulus griseus one. F6B F7A