IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. J. Biol. Chem. (0021-9258) 2008 imex curation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca Accepted 2009-DEC-10 by JYOTI. 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. J. Biol. Chem. (0021-9258) 2008 imex curation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca Accepted 2009-DEC-10 by JYOTI. 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. J. Biol. Chem. (0021-9258) 2008 imex curation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. The protein A moiety of the TAP-tagged proteins was detected by incubation with normal rabbit serum (binding to protein A) followed by detection using donkey anti-rabbit IgG conjugated to horseradish peroxidase. gingras@mshri.on.ca Accepted 2009-DEC-10 by JYOTI. 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. J. Biol. Chem. (0021-9258) 2008 imex curation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca Accepted 2009-DEC-10 by JYOTI. 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. J. Biol. Chem. (0021-9258) 2008 imex curation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. jyoti Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca Accepted 2009-DEC-10 by JYOTI. 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4. J. Biol. Chem. (0021-9258) 2008 imex curation Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Chen GI., Tisayakorn S., Jorgensen C., D'Ambrosio LM., Goudreault M., Gingras AC. Biological replicates were analyzed for FLAG-PP4c (n = 6), FLAG-PP4R4 (n = 3), and FLAG alone (n = 3). To generate the lists of high confidence-specific interactors, proteins detected in any of the FLAG-alone samples were subtracted from the final list. For the FLAG-PP4c sample, only those proteins that were detected in all biological replicates and with an averaged Mascot score (sum of Mascot scores across the 6 replicates/6) >250 and >5 averaged unique peptides (sum of unique peptides across the 6 replicates/6) are reported. gingras@mshri.on.ca Accepted 2009-DEC-10 by JYOTI. 23-Dec-2009: Contacted by JYOTI. 20091103: AC Gingras, Samuel Lunenfeld Research Institute at Mount Sinai Hospital, Toronto, Canada. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation tcpd_human T-complex protein 1 subunit delta CCT4 CCTD SRB CCT-delta Stimulator of TAR RNA-binding protein protein human Homo sapiens Human MPENVAPRSGATAGAAGGRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR DIP protein P50991 original sequence version: 100 39913C0D0735180D tcpa_human T-complex protein 1 subunit alpha CCTA TCP1 CCT1 CCT-alpha protein protein human Homo sapiens Human MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND DIP protein P17987 original sequence version: 114 DIP protein P17987 original sequence version: 123 486ECA836EA258A1 2a5d_human Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform PPP2R5D PP2A B subunit isoform B'-delta PP2A B subunit isoform B56-delta PP2A B subunit isoform PR61-delta PP2A B subunit isoform R5-delta protein protein human Homo sapiens Human MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL DIP protein Q14738 original sequence version: 92 F15F71AF4E565387 pp4c_human Serine/threonine-protein phosphatase 4 catalytic subunit Protein phosphatase X PPP4C PPP4 PPX protein protein human Homo sapiens Human MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL D6FE470A5C6CBCAC 2aab_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform PPP2R1B PP2A subunit A isoform PR65-beta PP2A subunit A isoform R1-beta protein protein human Homo sapiens Human MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA DIP protein P30154 original sequence version: 145 86AB20D7505210B0 igbp1_human Immunoglobulin-binding protein 1 IGBP1 IBP1 CD79a-binding protein 1 B-cell signal transduction molecule alpha 4 Renal carcinoma antigen NY-REN-16 Protein phosphatase 2/4/6 regulatory subunit protein protein human Homo sapiens Human MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG BB00A116EB45273A ccdc6_human Coiled-coil domain-containing protein 6 Protein H4 Papillary thyroid carcinoma-encoded protein CCDC6 D10S170 TST1 protein protein human Homo sapiens Human MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP DF055DBF20304D26 tcph_human T-complex protein 1 subunit eta CCT7 CCTH NIP7-1 CCT-eta HIV-1 Nef-interacting protein protein protein human Homo sapiens Human MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH DIP protein Q99832 original sequence version: 112 9F1E33FA80E6238E tcpg_human T-complex protein 1 subunit gamma CCT3 CCTG TRIC5 CCT-gamma hTRiC5 protein protein human Homo sapiens Human MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE DIP protein P49368 original sequence version: 109 DIP protein P49368 original sequence version: 147 DIP protein P49368 original sequence version: 117 0A528762EF24F36B pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 pp4r2_human Serine/threonine-protein phosphatase 4 regulatory subunit 2 PPP4R2 SBBI57 protein protein human Homo sapiens Human MDVERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCVYPSSEKNNSNSLNRMNGVMFPGNSPSYTERSNINGPGTPRPLNRPKVSLSAPMTTNGLPESTDSKEANLQQNEEKNHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNEETSEENNQMEESDVSQAEKDLLHSEGSENEGPVSSSSSDCRETEELVGSNSSKTGEILSESSMENDDEATEVTDEPMEQD 75298CD34A202F40 pp4c_mouse Serine/threonine-protein phosphatase 4 catalytic subunit Ppp4c Ppp4 Ppx Protein phosphatase X protein protein mouse Mus musculus Mouse MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL D6FE470A5C6CBCAC pp4r4_human Serine/threonine-protein phosphatase 4 regulatory subunit 4 KIAA1622 PP4R4 PPP4R4 protein protein human Homo sapiens Human MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVREALHVAGVEMQLTAAMSFLTILQDESVSIHAYTHSFLQVILLHLEHRDTGVSNAWLETLLSVIEVLPKETLRHEILNPLVSKAQLSQTVQSRLVSCKILGKLTNKFDAHTIKREILPLVKSLCQDVEYEVRSCMCRQLENIAQGIGTELTKSVVLPELIELSRDEGSSVRLAAFETLVNLLDIFDTDDRSQTILPLVKSFCEKSFKADESILISLSFHLGKLCHGLYGIFTPDQHLRFLEFYKKLCTLGLQQENGHNENQIPPQILEQEKKYISVRKNCAYNFPAMIVFVDPKNFHMELYSTFFCLCHDPEVPVRYTIAICFYEVSKLLNSGVYLIHKELITLLQDESLEVLDALIDHLPEILELMSTGGESSVQENKLSSLPDLIPALTAAEQRAAASLKWRTHEKLLQKYACLPHVISSDQIYYRFLQRMFTIMMTNNVLPVQKAASRTLCIFLRYNRKQEQRHEVIQKLIEQLGQGKSYWNRLRFLDTCEFIIEIFSKSFFCKYFFLPAIELTHDPVANVRMKLCYLLPKVKSTLKIPADKHLLQQLEMCVRKLLCQEKDKDVLAIVKRTVLELDRMEMSMDAFQKKFYEKDLLDQEKEREELLLLEMEQLEKEKQQNDGRPMSDKMFEKKRRDTKTPTQSLPKNIPISVPGPSSVTPSTSKEIKKSKLIRSQSFNNQAFHAKYGNLEKCASKSSTTGYTTSVSGLGKTSVLSLADDSFRTRNASSVPSSFSPNTPLPSTSRGTGNSVDPKSSGSKDTQPRKATLKSRKSNP 9C1A9CD4584447C1 prp16_human Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 DHX38 DDX38 KIAA0224 PRP16 ATP-dependent RNA helicase DHX38 DEAH box protein 38 protein protein human Homo sapiens Human MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRREREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETPSHPGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDRDERDRSRHSSRSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTPSYRDSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREEGEEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL 80D06118D0D465E5 tcpz_human T-complex protein 1 subunit zeta CCT6A CCT6 CCTZ CCT-zeta-1 Tcp20 HTR3 Acute morphine dependence-related protein 2 protein protein human Homo sapiens Human MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAEALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG DIP protein P40227 original sequence version: 109 43ABCF548CC82B81 tcpq_human T-complex protein 1 subunit theta CCT8 CCTQ KIAA0002 CCT-theta Renal carcinoma antigen NY-REN-15 C21orf112 Chaperonin containing T-complex polypeptide 1 subunit 8 protein protein human Homo sapiens Human MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQND DIP protein P50990 original sequence version: 110 566A6622BC2D15E9 p4r3b_human Serine/threonine-protein phosphatase 4 regulatory subunit 3B PPP4R3B KIAA1387 PP4R3B SMEK homolog 2 SMEK2 protein protein human Homo sapiens Human MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDFFLKHYRYSWSFICTPSHSHSHSTPSSSISQDNIVGSNKNNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESSPRKRPRLGS CEA2C74C0F2B3D27 pp4r4_mouse Serine/threonine-protein phosphatase 4 regulatory subunit 4 Ppp4r4 Kiaa1622 Pp4r4 protein protein mouse Mus musculus Mouse MHPPPPDAGVAMDFGQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIDRAVYLLSAGQDVQGASVIANLPFLMRQNPTETLRRVLPKVREVLHVASVEMQLTAAVSFLTILQEESMSVHTCAHSFLQVILLHLEHRDTGVSNAWLETLLSAVELLPKETLRHEILNPLVSKAQLSQTVQSRLVSCKILGKITNKFDAHSIKREILPLVKSLCQDVEYEVRSCMCRQLENIAQGIGAELTKNVVLPELIELSRDESGSVRLAAFETLVNMLDMFDTDDRSQTILPLVKSFCEKSFKADESILISLSFHLGKLCHGLYGIFTPDQHLRFLEFYKKLCTLGLQQENGHNESQIPSQIVEQEKKYTSVRKNCAYNFPAMIVFVDPKNFHMELYSTFFCLCHDPEVPVRHTIAICFYEVSKLLNSGVHLIHKELITLLQDESLEVLDALINHLPEILELMSTGGENSVQENKFSSVPDLIPALTAAEQRAAASLKWRTHEKLLQKYTCLPHIISSDQIYYRFLQRMFTIMMTNNVLPVQRAAARTLCIFLRYNRKQEQRHEVIQKLIEQLGQGKSYWNRLRFLDTCEFIIEIFSRSFFCKYFFLPVIELTHDPVANVRMKLCYLLPKVKSALKIPADMHLLQQLEMCVRKLLCQEKDKDVLAIVKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKHQSDGRLASDKSFEKKRRDSRTSTQSLSKNLPISVPGPSSSTASTSKEIKKSKLTRSQSFNNQAFHAKYGTLDKCASKSSTLAHTSSVSGLVRTAMLSLTDDSFRTRNASSVPASFSPNPVMPSTSRGPGNTADPKSSGSKDAQPRKATLKSRKSNP E9F94A9064291BD1 tcpb_human T-complex protein 1 subunit beta CCT2 99D8.1 CCTB CCT-beta protein protein human Homo sapiens Human MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC DIP protein P78371 original sequence version: 101 DIP protein P78371 original sequence version: 107 57F9E1720D84A31F 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 tcpe_human T-complex protein 1 subunit epsilon CCT5 CCTE KIAA0098 CCT-epsilon protein protein human Homo sapiens Human MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE DIP protein P48643 original sequence version: 108 164168BB80EF022A p4r3a_human Serine/threonine-protein phosphatase 4 regulatory subunit 3A PPP4R3A KIAA2010 PP4R3A SMEK homolog 1 SMEK1 MSTP033 protein protein human Homo sapiens Human MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDMSSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKITSKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS EDDB4E1F47197A94 pp4r1_human Serine/threonine-protein phosphatase 4 regulatory subunit 1 PPP4R1 MEG1 PP4R1 protein protein human Homo sapiens Human MADLSLLQEDLQEDADGFGVDDYSSESDVIIIPSALDFVSQDEMLTPLGRLDKYAASENIFNRQMVARSLLDTLREVCDDERDCIAVLERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKFLLPIVVRYLADQNNQVRKTSQAALLALLEQELIERFDVETKVCPVLIELTAPDSNDDVKTEAVAIMCKMAPMVGKDITERLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNVWGVRKACAECFMAVSCATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFANPSSSGQYFKEESKSSEEMSVENKNRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRASSLDAHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQDVVPQALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQWKVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYDYLRPIALNLCADKVSSVRWISYKLVSEMVKKLHAATPPTFGVDLINELVENFGRCPKWSGRQAFVFVCQTVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKDYFLASASCHQEAVEQTIMALQMDRDSDVKYFASIHPASTKISEDAMSTASSTY E1392E6BAD3B58CB ppp4c-pppr4r-1 6 19 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 28 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Table 1 ppp4c-pppr4r-2 5 18 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association We, therefore, assessed whether endogenous PP4R4 and PP4c could co-immunoprecipitate from mouse brain lysate. Fig. 2E ppp4c-pppr4r-3 2 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60510:p.His56Gln Phosphatase-dead mutation mutation certain certain sequence position certain certain certain sequence position certain H Q Wed May 02 18:46:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his56gln' Tue Jun 30 16:10:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His56Gln' P60510:p.Arg86Ala Phosphatase-dead mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 20:18:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg86ala' Tue Jun 30 17:07:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg86Ala' 19 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association As shown in Fig. 3A, HA-PP4R4 co-purifies only with FLAG-PP4c and not with the other PP2A family phosphatases. Fig. 3A, 3C The PPP4R4-PP4C interaction does not depend upon PP4C phosphatase activity; phosphatase-dead PP4C mutants (H56Q and R86A) interacted with PP4R4 as efficiently as the wild type protein. Q6NUP7, P60510 transfection. ppp4c-pppr4r-4 3 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D Q6NUP7, P60510 transfection. ppp4c-pppr4r-5 4 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60510:p.Glu39Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 19:41:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu39lys' Tue Jun 30 18:33:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu39Lys' P60510:p.Glu64Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 14:35:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu64lys' Tue Jun 30 16:52:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu64Lys' P60510:p.Asn76Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N D Wed May 02 18:41:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn76asp' Tue Jun 30 17:00:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn76Asp' P60510:p.Arg107Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:01:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg107glu' Tue Jun 30 16:31:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg107Glu' P60510:p.Glu277Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 15:53:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu277lys' Tue Jun 30 19:38:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu277Lys' 19 unspecified role unspecified role prey prey physical association physical association Fig. 3D, 6B P60510 transfection. Substitution (in PP4c) of Glu-64 or Glu-277 to lysine completely abolished the interaction with PP4R4, whereas substitution of Asn-76 by Asp or Arg-107 by Glu decreased, but did not abolish, binding (Fig. 6B). Although in Fig. 6B, this interaction was demonstrated in a one bait-many prey coimmunoperciptiation, it has been separated into known binary pairs in order to show the differing effects of the mutants on each interacting pair. ppp4c-ppp4r1-1 3 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role prey prey n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D Q8TF05, P60510 transfection. ppp4c-ppp2r1a-1 3 26 unspecified role unspecified role prey prey n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D P30153, P60510 transfection. ppp2ca-ppp2r1a-3 3 26 unspecified role unspecified role prey prey n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D P30153, P67775 transfection. ppp2ca-ppp2r1b-2 3 11 unspecified role unspecified role prey prey n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3D P30154, P67775 transfection. ppp4c-pppr4r-6 4 10 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6NUP7:p.Val618Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Wed May 02 19:22:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val618asp' Tue Jun 30 17:24:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val618Asp' Q6NUP7:p.Val618Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V A Wed May 02 17:17:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val618ala' Tue Jun 30 20:06:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val618Ala' Q6NUP7:p.Arg501Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 19:49:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg501asp' Tue Jun 30 15:50:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg501Asp' physical association physical association Fig. 6A P60510 transfection. The valine mutation was mapped to position 616 in the publication, this has been corrected to 618 in the entry. ppp4c-pppr4r2-1 4 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60510:p.Glu39Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 20:16:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu39lys' Tue Jun 30 20:12:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu39Lys' P60510:p.Asn76Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N D Wed May 02 17:55:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn76asp' Tue Jun 30 16:56:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn76Asp' P60510:p.Arg107Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 14:51:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg107glu' Tue Jun 30 18:23:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg107Glu' P60510:p.Glu277Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 18:19:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu277lys' Tue Jun 30 20:11:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu277Lys' 17 unspecified role unspecified role prey prey physical association physical association Fig. 6B P60510 transfection. Substitution (in PP4c) of Glu-64 or Glu-277 to lysine completely abolished the interaction with PP4R4, whereas substitution of Asn-76 by Asp or Arg-107 by Glu decreased, but did not abolish, binding (Fig. 6B). Although this interaction was demonstrated in a one bait-many prey coimmunopreciptiation, it has been separated into known binary pairs in order to show the differing effects of the mutants on each interacting pair. ppp4c-pppr4r1-1 4 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60510:p.Glu39Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:16:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu39lys' Tue Jun 30 18:54:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu39Lys' P60510:p.Glu64Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:23:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu64lys' Tue Jun 30 17:00:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu64Lys' P60510:p.Asn76Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N D Wed May 02 17:23:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn76asp' Tue Jun 30 19:10:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn76Asp' P60510:p.Arg107Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 20:05:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg107glu' Tue Jun 30 16:33:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg107Glu' P60510:p.Glu277Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 14:39:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu277lys' Tue Jun 30 17:24:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu277Lys' 29 unspecified role unspecified role prey prey physical association physical association Fig. 6B P60510 transfection. Although this interaction was demonstrated in a one bait-many prey coimmunopreciptiation, it has been separated into known binary pairs in order to show the differing effects of the mutants on each interacting pair. ppp4c-igbp1-1 4 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association Fig. 6B P60510 transfection. Although this interaction was demonstrated in a one bait-many prey coimmunopreciptiation, it has been separated into known binary pairs in order to show the differing effects of the mutants on each interacting pair. ppp4c-pppr4r-7 1 19 unspecified role unspecified role prey prey n-terminal strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig. 5B Q6NUP7, P60510 transfection.