MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. EMBO J. (0261-4189) 2008 imex curation Bhati M., Lee C., Nancarrow AL., Lee M., Craig VJ., Bach I., Guss JM., Mackay JP., Matthews JM. 2009-03-05 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bhati M., Lee C., Nancarrow AL., Lee M., Craig VJ., Bach I., Guss JM., Mackay JP., Matthews JM. EMBO J. (0261-4189) 2008 2009-03-05 Only protein-protein interactions imex curation Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. EMBO J. (0261-4189) 2008 imex curation Bhati M., Lee C., Nancarrow AL., Lee M., Craig VJ., Bach I., Guss JM., Mackay JP., Matthews JM. 2009-03-05 Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bhati M., Lee C., Nancarrow AL., Lee M., Craig VJ., Bach I., Guss JM., Mackay JP., Matthews JM. EMBO J. (0261-4189) 2008 2009-03-05 Only protein-protein interactions imex curation Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. EMBO J. (0261-4189) 2008 imex curation Bhati M., Lee C., Nancarrow AL., Lee M., Craig VJ., Bach I., Guss JM., Mackay JP., Matthews JM. 2009-03-05 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bhati M., Lee C., Nancarrow AL., Lee M., Craig VJ., Bach I., Guss JM., Mackay JP., Matthews JM. EMBO J. (0261-4189) 2008 2009-03-05 Only protein-protein interactions imex curation ldb1_mouse LIM domain-binding protein 1 Ldb1 Nli Carboxyl-terminal LIM domain-binding protein 2 LIM domain-binding factor CLIM2 Nuclear LIM interactor protein protein mouse Mus musculus Mouse MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ DIP protein P70662 original sequence version: 130 47C53DFA23044580 lhx3_mouse LIM/homeobox protein Lhx3 Lhx3 Lim-3 Lim3 Plim Homeobox protein LIM-3 Homeobox protein P-LIM protein protein mouse Mus musculus Mouse MLLEAELDCHRERPGAPGASALCTFSRTPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGSSKSDKDSIQEGQDSDAEVSFTDEPSMADMGPANGLYSSLGEPAPALGRPVGGLGSFTLDHGGLTGPEQYRELRPGSPYGIPPSPAAPQSLPGPQPLLSSLVYPDTNLSLVPSGPPGGPPPMRVLAGNGPSSDLSTESSSGYPDFPASPASWLDEVDHAQF Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with Pit-1 mint AD7A9453CFACC730 isl1_mouse Insulin gene enhancer protein ISL-1 Isl1 protein protein mouse Mus musculus Mouse MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA Binds to one of the cis-acting domain of the insulin gene enhancer mint 4DB82FD09154F404 lhx3-isl1 3 Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7009919: original sequence: 133-349 : HDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIE tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7009924: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK physical association physical association F1D homomint mint ldb1-lhx3 3 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010479: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P70662:p.Val339Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:17:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:12:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val339ala' Tue Jun 30 16:51:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val339Ala' range MINT-7010546: original sequence: 339-339 : ALSSQVPDVMVVGEPTLMGG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010485: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 mint ldb1-lhx3-1 3 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010561: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010554: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ P70662:p.Ile358Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:55:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:46:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile358ala' Tue Jun 30 19:29:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile358Ala' range MINT-7010569: original sequence: 358-358 : GEFGDEDERLITRLENTQFD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P70662:p.Met338Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Tue Jul 12 10:17:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:47:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met338ala' Tue Jun 30 16:57:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met338Ala' range MINT-7010552: original sequence: 338-338 : FALSSQVPDVMVVGEPTLMG physical association physical association T3 mint ldb1-lhx3-2 3 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010581: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P70662:p.Ile358Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:18:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:23:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile358ala' Tue Jun 30 19:58:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile358Ala' range MINT-7010585: original sequence: 358-358 : GEFGDEDERLITRLENTQFD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010589: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ P70662:p.Thr344Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:56:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:57:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr344ala' Tue Jun 30 16:37:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr344Ala' range MINT-7010591: original sequence: 344-344 : VPDVMVVGEPTLMGGEFGDE tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 mint ldb1-lhx3-3 3 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010611: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P70662:p.Leu345Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:19:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:07:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu345ala' Tue Jun 30 16:29:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu345Ala' range MINT-7010600: original sequence: 345-345 : PDVMVVGEPTLMGGEFGDED P70662:p.Ile358Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:19:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:13:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile358ala' Tue Jun 30 17:14:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile358Ala' range MINT-7010606: original sequence: 358-358 : GEFGDEDERLITRLENTQFD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010602: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 mint ldb1-isl1 3 Lhx3 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010631: original sequence: 17-70 : CVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010624: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P70662:p.Thr359Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:52:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:33:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr359ala' Tue Jun 30 16:55:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr359Ala' range MINT-7010622: original sequence: 359-359 : EFGDEDERLITRLENTQFDA physical association physical association T3 mint ldb1-isl1-1 3 Lhx3 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010647: original sequence: 17-70 : CVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:32:27 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 356-358Ala range MINT-7010655: original sequence: 356-358 : MGGEFGDEDERLITRLENTQFD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010653: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ physical association physical association T3 mint ldb1-isl1-2 3 Lhx3 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010673: original sequence: 17-70 : CVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:34:05 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 359-361Ala range MINT-7010664: original sequence: 359-361 : EFGDEDERLITRLENTQFDAAN binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010666: original sequence: 336-366 : DVMVVGEPTLMGGEFGDEDERLITRLENTQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 mint isl1-lhx3 3 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010691: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P61372:p.Met265Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Tue Jul 12 10:53:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:36:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met265ala' Tue Jun 30 16:53:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met265Ala' range MINT-7010704: original sequence: 265-265 : TNIQGMTGTPMVAASPERHD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010697: original sequence: 262-292 : GTPMVAASPERHDGGLQANPVEVQSYQPPW tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 homomint mint isl1-lhx3-1 3 Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:34:38 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Pro267Ala range MINT-7010753: original sequence: 267-267 : IQGMTGTPMVAASPERHDGG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010715: original sequence: 262-292 : GTPMVAASPERHDGGLQANPVEVQSYQPPW undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:34:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Gly265Ala range MINT-7010713: original sequence: 265-265 : TNIQGMTGTPMVAASPERHD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:34:45 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr266Ala range MINT-7010750: original sequence: 266-266 : NIQGMTGTPMVAASPERHDG Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010722: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 homomint mint isl1-lhx3-2 3 Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010742: original sequence: 262-292 : GTPMVAASPERHDGGLQANPVEVQSYQPPW tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61372:p.Ala267Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G Tue Jul 12 10:06:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:40:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala267gly' Tue Jun 30 18:33:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala267Gly' range MINT-7010744: original sequence: 267-267 : IQGMTGTPMVAASPERHDGG Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010736: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T3 homomint mint lhx3-isl1-1 3 Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:30:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Thr266Ala range MINT-7010768: original sequence: 266-266 : NIQGMTGTPMVAASPERHDG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010774: original sequence: 262-292 : GTPMVAASPERHDGGLQANPVEVQSYQPPW tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:30:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Gly265Ala range MINT-7010770: original sequence: 265-265 : TNIQGMTGTPMVAASPERHD undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:29:40 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Pro267Ala range MINT-7010766: original sequence: 267-267 : IQGMTGTPMVAASPERHDGG Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010762: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK physical association physical association T3 homomint mint lhx3-isl1-2 3 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010830: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7010836: original sequence: 262-292 : GTPMVAASPERHDGGLQANPVEVQSYQPPW tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61372:p.Met265Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Tue Jul 12 10:52:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:49:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met265ala' Tue Jun 30 19:12:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met265Ala' range MINT-7010838: original sequence: 265-265 : TNIQGMTGTPMVAASPERHD physical association physical association T3 homomint mint isl1-lhx3-3 1 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7009901: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK Isl1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7009896: original sequence: 262-291 : GTPMVAASPERHDGGLQANPVEVQSYQPP direct interaction direct interaction t2 homomint mint ldb1-lhx3-4 2 Lhx3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7009911: original sequence: 28-153 : TPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAK Ldb1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7009907: original sequence: 295-340 : KRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMV direct interaction direct interaction F2 mint