MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The structure and interactions of the proline-rich domain of ASPP2. The structure and interactions of the proline-rich domain of ASPP2. J. Biol. Chem. (0021-9258) 2008 mimix curation Rotem S., Katz C., Benyamini H., Lebendiker M., Veprintsev D., Rüdiger S., Danieli T., Friedler A. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Rotem S., Katz C., Benyamini H., Lebendiker M., Veprintsev D., Rüdiger S., Danieli T., Friedler A. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2008 partial coverage mimix curation mimix curation The structure and interactions of the proline-rich domain of ASPP2. The structure and interactions of the proline-rich domain of ASPP2. J. Biol. Chem. (0021-9258) 2008 mimix curation Rotem S., Katz C., Benyamini H., Lebendiker M., Veprintsev D., Rüdiger S., Danieli T., Friedler A. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Rotem S., Katz C., Benyamini H., Lebendiker M., Veprintsev D., Rüdiger S., Danieli T., Friedler A. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2008 partial coverage mimix curation mimix curation The structure and interactions of the proline-rich domain of ASPP2. The structure and interactions of the proline-rich domain of ASPP2. J. Biol. Chem. (0021-9258) 2008 mimix curation Rotem S., Katz C., Benyamini H., Lebendiker M., Veprintsev D., Rüdiger S., Danieli T., Friedler A. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Rotem S., Katz C., Benyamini H., Lebendiker M., Veprintsev D., Rüdiger S., Danieli T., Friedler A. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci J. Biol. Chem. (0021-9258) 2008 partial coverage mimix curation mimix curation tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 aspp2_human Apoptosis-stimulating of p53 protein 2 TP53BP2 ASPP2 BBP Tumor suppressor p53-binding protein 2 Bcl2-binding protein Renal carcinoma antigen NY-REN-51 protein protein human Homo sapiens Human MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA DIP protein Q13625 original sequence version: 114 DIP protein Q13625 original sequence version: 156 DIP protein Q13625-1 original sequence version: 156 DIP protein Q13625 original sequence version: 160 DIP protein Q13625-1 original sequence version: 86 C75D056FBC1DAD75 pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK DIP protein P36873 original sequence version: 169 DIP protein P36873 original sequence version: 177 0EEEF0E842188536 tp53bp2-tp53bp2 2 ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4a homomint domino mint tp53bp2-tp53bp2-1 3 ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t1 f5a tp53bp2-tp53bp2-2 3 ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t1 f5a tp53bp2-tp53bp2-3 3 ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t2 f5c tp53bp2-tp53bp2-4 3 ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t2 f5c rela-tp53bp2-6 3 NF-kappaB p65 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t3 f6b p65 NF-kappa B taxid has not been specified ppp1cc-tp53bp2-1 3 ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PP1 7 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t3 f6b PP1 taxid has not been specified bcl2l2-tp53bp2 3 Bcl-W 5 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint t3 f6b Bcl-W taxid has not been specified tp53bp2-tp53bp2-5 1 ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint f5e domino mint to detect the interaction Anisotropy fluorescence has been used rela-tp53bp2-7 1 NF-kappa-B p65 4 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7a homomint domino mint to detect the interaction Anisotropy fluorescence has been used NF-kappaB taxid has not been specified rela-tp53bp2-8 1 NF-kappa-B p65 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7a homomint domino mint to detect the interaction Anisotropy fluorescence has been used NF-kappaB p65 taxid has not been specified tp53bp2-rela 1 NF-kappa-B p65 4 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f7b homomint domino mint to detect the interaction Anisotropy fluorescence has been used NF-kappaB p65 taxid has not been specified tp53bp2-tp53bp2-6 1 ASPP2 6 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NF-kappa-B p65 6 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint domino mint to detect the interaction Anisotropy fluorescence has been used f7c f7d