IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis. CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis. Plant J. (0960-7412) 2008 imex curation Hong SH., Kim HJ., Ryu JS., Choi H., Jeong S., Shin J., Choi G., Nam HG. Tagged proteins were transfected into Arabidopsis mesophyll cell protoplasts. These were incubated overnight in darkness prior to co-immunoprecipitation analysis. nam@postech.ac.kr jyoti Only protein-protein interactions arath-mesophyll Arabidopsis thaliana mesophyll mesophyll Mesophyll of plant leaf The photosynthetic parenchyma between the epidermal layers of a foliage leaf. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Hong SH., Kim HJ., Ryu JS., Choi H., Jeong S., Shin J., Choi G., Nam HG. Tagged proteins were transfected into Arabidopsis mesophyll cell protoplasts. These were incubated overnight in darkness prior to co-immunoprecipitation analysis. nam@postech.ac.kr Accepted 2009-MAY-20 by JYOTI. Plant J. (0960-7412) 2008 jyoti Only protein-protein interactions imex curation CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis. CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis. Plant J. (0960-7412) 2008 imex curation Hong SH., Kim HJ., Ryu JS., Choi H., Jeong S., Shin J., Choi G., Nam HG. Tagged proteins were transfected into Arabidopsis mesophyll cell protoplasts. These were incubated overnight in darkness prior to co-immunoprecipitation analysis. nam@postech.ac.kr jyoti Only protein-protein interactions arath-mesophyll Arabidopsis thaliana mesophyll mesophyll Mesophyll of plant leaf The photosynthetic parenchyma between the epidermal layers of a foliage leaf. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hong SH., Kim HJ., Ryu JS., Choi H., Jeong S., Shin J., Choi G., Nam HG. Tagged proteins were transfected into Arabidopsis mesophyll cell protoplasts. These were incubated overnight in darkness prior to co-immunoprecipitation analysis. nam@postech.ac.kr Accepted 2009-MAY-20 by JYOTI. Plant J. (0960-7412) 2008 jyoti Only protein-protein interactions imex curation CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis. CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis. Plant J. (0960-7412) 2008 imex curation Hong SH., Kim HJ., Ryu JS., Choi H., Jeong S., Shin J., Choi G., Nam HG. Tagged proteins were transfected into Arabidopsis mesophyll cell protoplasts. These were incubated overnight in darkness prior to co-immunoprecipitation analysis. nam@postech.ac.kr jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hong SH., Kim HJ., Ryu JS., Choi H., Jeong S., Shin J., Choi G., Nam HG. Tagged proteins were transfected into Arabidopsis mesophyll cell protoplasts. These were incubated overnight in darkness prior to co-immunoprecipitation analysis. nam@postech.ac.kr Accepted 2009-MAY-20 by JYOTI. Plant J. (0960-7412) 2008 jyoti Only protein-protein interactions imex curation cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA DIP protein P43254 original sequence version: 138 DIP protein P43254 original sequence version: 113 DIP protein P43254 original sequence version: 114 E6D9A1B702EAE8F0 rax2_arath Transcription factor RAX2 RAX2 MYB38 Protein REGULATOR OF AXILLARY MERISTEMS 2 Myb-related protein 38 T1J8.7 At2g36890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRAPCCDKANVKRGPWSPEEDAKLKDYIEKQGTGGNWIALPHKAGLRRCGKSCRLRWLNYLRPNIRHGDFTEEEDNIIYSLFASIGSRWSVIAAHLQGRTDNDIKNYWNTKLKKKLIATMAPPPHHHLAIATSSSSASPSSSSHYNMINSLLPYNPSTNQLLTPHQGIMMTMMGQQQQLFYQEDMGNLVNSPNRNNLIMSHQEDNQEQSTNKGIMLLSDVRSGSSTTSTVTRVKMEHRDHDDHHHHHEEDERSMTSVVMEDYGMEEIKQLISSSCTSSNNSLWFDENKTEDKFMLYY 2554D975914869F8 bit1-cop1 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 5b Interaction between BIT1 and COP1 in the yeast two-hybrid system. The authors do not provide an accession number for COP1. The curator assumes they are mean protein P43254 since they describe COP1 as a E3 ubiquitin-protein ligase" which is involved in photomorphogenesis. bit1-cop1-1 1 5 unspecified role unspecified role neutral component neutral component region N terminal region YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region C terminal region YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5c Figure S5 Interaction between BIT1 and COP1 using a bimolecular fluorescence complementation (BiFC) assay. The authors do not provide an accession number for COP1. The curator assumes they are mean protein P43254 since they describe COP1 as a E3 ubiquitin-protein ligase" which is involved in photomorphogenesis. bit1-cop1-2 2 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5d Interaction between BIT1 and COP1 in an in vivo co-immunoprecipitation assay. The authors do not provide an accession number for COP1. The curator assumes they are mean protein P43254 since they describe COP1 as a E3 ubiquitin-protein ligase" which is involved in photomorphogenesis.