MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2. SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2. J. Cell. Sci. (0021-9533) 2008 mimix curation Shin N., Ahn N., Chang-Ileto B., Park J., Takei K., Ahn SG., Kim SA., Di Paolo G., Chang S. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Shin N., Ahn N., Chang-Ileto B., Park J., Takei K., Ahn SG., Kim SA., Di Paolo G., Chang S. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci J. Cell. Sci. (0021-9533) 2008 partial coverage mimix curation mimix curation SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2. SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2. J. Cell. Sci. (0021-9533) 2008 mimix curation Shin N., Ahn N., Chang-Ileto B., Park J., Takei K., Ahn SG., Kim SA., Di Paolo G., Chang S. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shin N., Ahn N., Chang-Ileto B., Park J., Takei K., Ahn SG., Kim SA., Di Paolo G., Chang S. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci J. Cell. Sci. (0021-9533) 2008 partial coverage mimix curation mimix curation SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2. SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2. J. Cell. Sci. (0021-9533) 2008 mimix curation Shin N., Ahn N., Chang-Ileto B., Park J., Takei K., Ahn SG., Kim SA., Di Paolo G., Chang S. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci partial coverage mimix curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Shin N., Ahn N., Chang-Ileto B., Park J., Takei K., Ahn SG., Kim SA., Di Paolo G., Chang S. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci J. Cell. Sci. (0021-9533) 2008 partial coverage mimix curation mimix curation araid_human All-trans retinoic acid-induced differentiation factor ATRAID APR3 Apoptosis-related protein 3 C2orf28 p18 HSPC013 UNQ214/PRO240 protein protein human Homo sapiens Human MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS CF051C5E886BCFF1 dyn2_human Dynamin-2 DNM2 DYN2 protein protein human Homo sapiens Human MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD DIP protein P50570 original sequence version: 149 DIP protein P50570 original sequence version: 100 DIP protein P50570 original sequence version: 160 2F4567B75980935D wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED DIP protein O00401 original sequence version: 55 DIP protein O00401 original sequence version: 147 DIP protein O00401 original sequence version: 150 DIP protein O00401 original sequence version: 136 DIP protein O00401 original sequence version: 138 DIP protein O00401 original sequence version: 125 DIP protein O00401 original sequence version: 112 DIP protein O00401 original sequence version: 126 B5895C6055E23049 snx9_human Sorting nexin-9 SNX9 SH3PX1 SH3PXD3A SH3 and PX domain-containing protein 1 SH3 and PX domain-containing protein 3A protein protein human Homo sapiens Human MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM DIP protein Q9Y5X1 original sequence version: 123 DIP protein Q9Y5X1 original sequence version: 70 963892AC1A5A9227 snx9-dnm2-1 3 SNX9 7 unspecified role unspecified role bait bait gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Dynamin-2 5 unspecified role unspecified role prey prey physical association physical association f4a homomint domino mint snx9-wasl 3 SNX9 7 unspecified role unspecified role bait bait gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain N-WASP 6 unspecified role unspecified role prey prey physical association physical association f4a homomint domino mint snx9-atraid 3 APR3 4 unspecified role unspecified role prey prey SNX9 7 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain LC domain physical association physical association homomint mint f5c f5d Apr3 taxid has not been specified. snx9-wasl-1 2 N-WASP 6 unspecified role unspecified role prey prey gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SNX9 7 unspecified role unspecified role bait bait flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f4b homomint domino mint N-WASP taxid has not been specified. snx9-dnm2-2 2 SNX9 7 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Dynamin-2 5 unspecified role unspecified role prey prey gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4b homomint domino mint Dynamin2 taxid has not been specified. atraid-snx9 1 SNX9 7 unspecified role unspecified role prey prey APR3 4 unspecified role unspecified role bait bait physical association physical association f5a homomint mint Proteins taxid has been inferred to human accession number although the interaction has been detected in COS7 (Cercopithecus aethiops) cells.