IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Wobble inosine tRNA modification is essential to cell cycle progression in G(1)/S and G(2)/M transitions in fission yeast. Wobble inosine tRNA modification is essential to cell cycle progression in G(1)/S and G(2)/M transitions in fission yeast. J. Biol. Chem. (0021-9258) 2007 imex curation Tsutsumi S., Sugiura R., Ma Y., Tokuoka H., Ohta K., Ohte R., Noma A., Suzuki T., Kuno T. tkuno@med.kobe-u.ac.jp 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Tsutsumi S., Sugiura R., Ma Y., Tokuoka H., Ohta K., Ohte R., Noma A., Suzuki T., Kuno T. tkuno@med.kobe-u.ac.jp Accepted 2009-Not a month!-22 by JYOTI. 23-Feb-2010: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2007 jyoti Only protein-protein interactions imex curation tad2_schpo tRNA-specific adenosine deaminase subunit tad2 tad2 tRNA-specific adenosine-34 deaminase subunit tad2 SPBC16D10.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAGDSVKSAIIGIAGGPFSGKTQLCEQLLERLKSSAPSTFSKLIHLTSFLYPNSVDRYALSSYDIEAFKKVLSLISQGAEKICLPDGSCIKLPVDQNRIILIEGYYLLLPELLPYYTSKIFVYEDADTRLERCVLQRVKAEKGDLTKVLNDFVTLSKPAYDSSIHPTRENADIILPQKENIDTALLFVSQHLQDILAEMNKTSSSNTVKYDTQHETYMKLAHEILNLGPYFVIQPRSPGSCVFVYKGEVIGRGFNETNCSLSGIRHAELIAIEKILEHYPASVFKETTLYVTVEPCLMCAAALKQLHIKAVYFGCGNDRFGGCGSVFSINKDQSIDPSYPVYPGLFYSEAVMLMREFYVQENVKAPVPQSKKQRVLKREVKSLDLSRFK 0182DE8A2DC3606C tad3_schpo tRNA-specific adenosine deaminase subunit tad3 tad3 tRNA-specific adenosine-34 deaminase subunit tad3 SPAP27G11.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVKTNISKNSPKEATVPELDWPFKLIKSHLETRKLETENVWIACFEPKYASKVTQYVKQIRSKQKESLLHCNRLRRIQDENGSLELQIIICPEKSMTANEIGKDFEDLGIVSKMIFLYAVPAFPPLTDEQFHEWNSVWPVSYRKHVQRQDVFTVHELKRIESILEDLINAAGASHKHGEIGCAAAIYDPTTDTVLAVSVDERSKLKNPINHCVMNAINLVAKRELSRRQNRTDGSKDRYLCKDLTVVMTHEPCVMCSMGLLHSRIRRLIYCKKQPLTGGIESLYGIHWRAELNHRYLAYSGWNKPVPSIKENIHV 5B4F8203EC8ABA0F tad2-tad3 1 2 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait Q9P7N4:p.Ser257Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:37:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser257asn' Tue Jun 30 17:09:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser257Asn' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association The pull-down experiments showed that GFP-Tad2 associated with GST-Tad3 but not with GST, thus confirming the physical interaction between Tad2 and Tad3. Fig. 5B