MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction. Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction. Int. J. Biochem. Cell Biol. (1357-2725) 2007 mimix curation only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci ndimasi@gmail.com partial coverage mimix curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci ndimasi@gmail.com Int. J. Biochem. Cell Biol. (1357-2725) 2007 partial coverage mimix curation mimix curation Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction. Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction. Int. J. Biochem. Cell Biol. (1357-2725) 2007 mimix curation only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci ndimasi@gmail.com partial coverage mimix curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci ndimasi@gmail.com Int. J. Biochem. Cell Biol. (1357-2725) 2007 partial coverage mimix curation mimix curation lcp2_human Lymphocyte cytosolic protein 2 LCP2 SH2 domain-containing leukocyte protein of 76 kDa SLP-76 tyrosine phosphoprotein protein protein human Homo sapiens Human MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP DIP protein Q13094 original sequence version: 141 DIP protein Q13094 original sequence version: 98 DIP protein Q13094 original sequence version: 113 C5D22F31D36200C8 grap2_human GRB2-related adapter protein 2 Protein GADS Growth factor receptor-binding protein GRBLG Grf40 adapter protein GRB-2-like protein GRBX P38 Hematopoietic cell-associated adapter protein GrpL Adapter protein GRID SH3-SH2-SH3 adapter Mona GRAP2 GADS GRB2L GRID protein protein human Homo sapiens Human MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR DIP protein O75791 original sequence version: 111 74F4C8D0EBB56D55 grap2_mouse GRB2-related adaptor protein 2 GADS protein Growth factor receptor-binding protein GRBLG GRB-2-like protein Hematopoietic cell-associated adaptor protein GrpL GRB-2-related monocytic adapter protein Adapter protein GRID Grap2 Gads Grb2l Grid Mona protein protein mouse Mus musculus Mouse MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR DIP protein O89100 original sequence version: 91 736311D0640CD3D0 grap2-lcp2-1 2 SLP76 3 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041302: original sequence: 233-241 : RNHKTAKLPAPSIDRSTKPPLDRSLAPF GADS 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041297: original sequence: 267-322 : LQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFP direct interaction direct interaction homomint domino mint F1B F2 F3 F5 grap2-lcp2-2 2 SLP76 3 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041342: original sequence: 233-241 : RNHKTAKLPAPSIDRSTKPPLDRSLAPF Stoichiometry: 1.0 GADS 4 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041347: original sequence: 233-241 : RNHKTAKLPAPSIDRSTKPPLDRSLAPF Stoichiometry: 2.0 physical association physical association f6 homomint domino mint SLP-76 promotes or/and stabilizes GADS-cSH3 homodimerization grap2-lcp2-3 1 SLP76 3 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041314: original sequence: 233-241 : RNHKTAKLPAPSIDRSTKPPLDRSLAPF GADS 5 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-7041319: original sequence: 267-322 : LQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFP direct interaction direct interaction F1A homomint domino mint