MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Rapid identification of 14-3-3-binding proteins by protein microarray analysis. Rapid identification of 14-3-3-binding proteins by protein microarray analysis. J. Neurosci. Methods (0165-0270) 2006 mimix curation Satoh J., Nanri Y., Yamamura T. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci satoj@ncnp.go.jp partial coverage mimix curation human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Satoh J., Nanri Y., Yamamura T. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci satoj@ncnp.go.jp J. Neurosci. Methods (0165-0270) 2006 partial coverage mimix curation mimix curation Rapid identification of 14-3-3-binding proteins by protein microarray analysis. Rapid identification of 14-3-3-binding proteins by protein microarray analysis. J. Neurosci. Methods (0165-0270) 2006 mimix curation Satoh J., Nanri Y., Yamamura T. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci satoj@ncnp.go.jp partial coverage mimix curation in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Satoh J., Nanri Y., Yamamura T. only a selection of interactions described in this publication have been curated SH3 suggested by mcarducci satoj@ncnp.go.jp J. Neurosci. Methods (0165-0270) 2006 partial coverage mimix curation mimix curation 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 stac_human SH3 and cysteine-rich domain-containing protein STAC Src homology 3 and cysteine-rich domain-containing protein STAC1 protein protein human Homo sapiens Human MIPPSSPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNFFQRTNSEDMKLQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTFCDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQITLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI 211688D178E4F905 stac-ywhae 2 14-3-3 protein epsilon 3 unspecified role unspecified role prey prey STAC 4 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction homomint mint t2 f1a f1f ywhae-stac 1 14-3-3 protein epsilon 3 unspecified role unspecified role bait bait STAC 4 unspecified role unspecified role prey prey physical association physical association f2a homomint mint