IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ FHL is required for full phytochrome A signaling and shares overlapping functions with FHY1. FHL is required for full phytochrome A signaling and shares overlapping functions with FHY1. Plant J. (0960-7412) 2005 imex curation Zhou Q., Hare PD., Yang SW., Zeidler M., Huang LF., Chua NH. chua@rockefeller.edu orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhou Q., Hare PD., Yang SW., Zeidler M., Huang LF., Chua NH. chua@rockefeller.edu Accepted 2009-SEP-27 by ORCHARD. Plant J. (0960-7412) 2005 orchard Only protein-protein interactions imex curation fhy1_arath Protein FAR-RED ELONGATED HYPOCOTYL 1 FHY1 PAT3 Protein PHYTOCHROME A SIGNAL TRANSDUCTION 3 F13M22 At2g37678 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPEVEVDNNNEKPSEINSFHHMIISSSKNVLKMEEVEVSKKRKFQTDQSDELSLLPLSKHTCFANVACSENTNGNSEIDTEYSMSSYVNSTTSMECNNDIEMKEESSGSCGEDKMISFESHLDYIYGTQNLEDFSEKVIENILYLDEQEEEEEDAKGCSSNAAKFVLSSGRWTVNQDDSTLHETKKPTIDQEFEQYFSTLML F0E3056D4CFCE0E3 fhl_arath Protein FAR-RED-ELONGATED HYPOCOTYL 1-LIKE FHL T7H20.250 At5g02200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDDADKSCSPSLDHSDINDPMIVAVESLDTSKKRKLHAEESDLLPLPKHFCSEHQASLVNSSCPSSVIDYAECSYAMENTKTSDEASSSASFTGPSLYMFKDSIYSTGSSSSGYAATSSIEQCFSKVDHKTQEDTQDFTHMEFIYHDSEFAVEDLQEVLNPVESYILSSARWSVSNQDSKEATTKPTIDQEFEQYFSTLMM 842F8A47AD141007 fhy-1 1 2 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 7c FHL and FHY1 homodimerize and heterodimerize in vitro fhy-fhl 1 3 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 7d fhl-1 1 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 7b