UniProt UniProt http://www.uniprot.org RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. Cell (0092-8674) 2005 imex curation LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk Accepted 2009-FEB-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. Cell (0092-8674) 2005 orchard Only protein-protein interactions imex curation RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. Cell (0092-8674) 2005 imex curation LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap weight silver stain molecular weight estimation by silver staining weight silver stain LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk Accepted 2009-FEB-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. Cell (0092-8674) 2005 orchard Only protein-protein interactions imex curation RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. Cell (0092-8674) 2005 imex curation LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk Accepted 2009-FEB-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. Cell (0092-8674) 2005 orchard Only protein-protein interactions imex curation RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. Cell (0092-8674) 2005 imex curation LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant LaCava J., Houseley J., Saveanu C., Petfalski E., Thompson E., Jacquier A., Tollervey D. d.tollervey@ed.ac.uk Accepted 2009-FEB-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. Cell (0092-8674) 2005 orchard Only protein-protein interactions imex curation pap2_yeast Poly(A) RNA polymerase protein 2 TRF4 HRC584 O0716 YOL115W PAP2 DNA polymerase sigma DNA polymerase kappa Topoisomerase 1-related protein TRF4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGAKSVTASSSKKIKNRHNGKVKKSKKIKKVRKPQKSISLNDENEVEILPSRNEQETNKLPKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPSTTEESKTPSLAVHGDEKDLANNDDFISLSASSEDEQAEQEEEREKQELEIKKEKQKEILNTDYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTNGIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFAGAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNKAIIENENYHKKRSRIIHDEDFAEDTVTSTATATTTDDDYEITNPPAKKAKIEEKPESEPAKRNSGETYITVSSEDDDEDGYNPYTL 8A58B29E4BFDC022 8A58B29E4BFDC022 air2_yeast Protein AIR2 Arginine methyltransferase-interacting RING finger protein 2 AIR2 YDL175C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR 5915C97FA39D6AFC 5915C97FA39D6AFC mtr4_yeast ATP-dependent RNA helicase DOB1 MTR4 DOB1 YJL050W J1158 mRNA transport regulator MTR4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSTDLFDVFEETPVELPTDSNGEKNADTNVGDTPDHTQDKKHGLEEEKEEHEENNSENKKIKSNKSKTEDKNKKVVVPVLADSFEQEASREVDASKGLTNSETLQVEQDGKVRLSHQVRHQVALPPNYDYTPIAEHKRVNEARTYPFTLDPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVEDEENVKEYHEIEQAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAKRINKRNPSAVYTDHESYIVNVVVNTMYIDSPVNLLKPFNPTLPEGIRPAEEGEKSICAVIPITLDSIKSIGNLRLYMPKDIRASGQKETVGKSLREVNRRFPDGIPVLDPVKNMKIEDEDFLKLMKKIDVLNTKLSSNPLTNSMRLEELYGKYSRKHDLHEDMKQLKRKISESQAVIQLDDLRRRKRVLRRLGFCTPNDIIELKGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREIAAKIAKIMKDSKIEVVEKDYVESFRHELMEVVYEWCRGATFTQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNSSLKEKMEAVLKLIHRDIVSAGSLYL 1FA9EAADC546F669 1FA9EAADC546F669 trf5_yeast Poly(A) RNA polymerase protein 1 TRF5 YNL299W N0440 Topoisomerase 1-related protein TRF5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTRLKAKYSPTKGKRKEDKHTKRMRKSSFTRTQKMLEVFNDNRSHFNKYESLAIDVEDDDTFGNLVLMENDKSDVDIPVIEEVTSSEDEQRAESSKRNNSLEDNQDFIAFSDSSEDETEQIKEDDDERSSFLLTDEHEVSKLTSQQSLNTESACNVEYPWIRNHCHSKQRRIADWLTSEIKDFVHYISPSKNEIKCRNRTIDKLRRAVKELWSDADLHVFGSFATDLYLPGSDIDCVVNSRNRDKEDRNYIYELARHLKNKGLAIRMEVIVKTRVPIIKFIEPQSQLHIDVSFERTNGLEAAKLIREWLRDSPGLRELVLIIKQFLHSRRLNNVHTGGLGGFTVICLVYSFLNMHPRIKSNDIDVLDNLGVLLIDFFELYGKNFGYDDVAISISDGYASYIPKSCWRTLEPSRSKFSLAIQDPGDPNNNISRGSFNMKDIKKAFAGAFELLVNKCWELNSATFKDRVGKSILGNVIKYRGQKRDFNDERDLVQNKAIIENERYHKRRTRIVQEDLFINDTEDLPVEEIYKLDEPAKKKQKAKKDKREGEIKKSAIPSPPPDFGVSRSKLKRKVKKTDQGSLLHQNNLSIDDLMGLSENDQESDQDQKGRDTPSGQDEKSPLETKTVDAQTRRDYWLSKGQAL 67D4CD75AEBAE1A4 mtr4-trf4-2 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Table S1 mtr4-trf5-1 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table S1 air2-mtr4-1 4 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 1B trf4-mtr4-2 4 5 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey physical association physical association Fig 1B Mtr4p and Air2p coprecipitated with Trf4p-TAP, again with apparent stoichiometry trf5-mtr4-3 4 8 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Fig 1B Mtr4p coprecipitated with Trf5p-TAP, mtr4-air2-1 4 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey physical association physical association Fig 1B Finally, Trf4p, Trf5p, and Air2p coprecipitated with Mtr4p-TAP; however, in this case, the recovery of Mtr4p was clearly greater than the other proteins. air2-mtr4-2 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 1C trf4-mtr4-3 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 1C trf5-mtr4-4 1 8 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Fig 1C trf4-mtr4-4 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey physical association physical association Fig S1