UniProt UniProt http://www.uniprot.org Physical and genetic interactions link the yeast protein Zds1p with mRNA nuclear export. Physical and genetic interactions link the yeast protein Zds1p with mRNA nuclear export. J. Biol. Chem. (0021-9258) 2005 imex curation Estruch F., Hodge CA., Rodriguez-Navarro S., Cole CN. francisco.estruch@uv.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. Yeast genomic library davet Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Estruch F., Hodge CA., Rodriguez-Navarro S., Cole CN. francisco.estruch@uv.es Accepted 2009-FEB-14 by DAVET. 03-Mar-2009: Contacted by JYOTI. Yeast genomic library J. Biol. Chem. (0021-9258) 2005 davet Only protein-protein interactions imex curation Physical and genetic interactions link the yeast protein Zds1p with mRNA nuclear export. Physical and genetic interactions link the yeast protein Zds1p with mRNA nuclear export. J. Biol. Chem. (0021-9258) 2005 imex curation Estruch F., Hodge CA., Rodriguez-Navarro S., Cole CN. francisco.estruch@uv.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. Yeast genomic library davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Estruch F., Hodge CA., Rodriguez-Navarro S., Cole CN. francisco.estruch@uv.es Accepted 2009-FEB-14 by DAVET. 03-Mar-2009: Contacted by JYOTI. Yeast genomic library J. Biol. Chem. (0021-9258) 2005 davet Only protein-protein interactions imex curation Physical and genetic interactions link the yeast protein Zds1p with mRNA nuclear export. Physical and genetic interactions link the yeast protein Zds1p with mRNA nuclear export. J. Biol. Chem. (0021-9258) 2005 imex curation Estruch F., Hodge CA., Rodriguez-Navarro S., Cole CN. francisco.estruch@uv.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. Yeast genomic library davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Estruch F., Hodge CA., Rodriguez-Navarro S., Cole CN. francisco.estruch@uv.es Accepted 2009-FEB-14 by DAVET. 03-Mar-2009: Contacted by JYOTI. Yeast genomic library J. Biol. Chem. (0021-9258) 2005 davet Only protein-protein interactions imex curation dbp5_yeast ATP-dependent RNA helicase DBP5 YOR046C DBP5 RAT8 DEAD box protein 5 Helicase CA5/6 Ribonucleic acid-trafficking protein 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDTKRDPADLLASLKIDNEKEDTSEVSTKETVKSQPEKTADSIKPAEKLVPKVEEKKTKQEDSNLISSEYEVKVKLADIQADPNSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD C50CAFE8C060D46B C50CAFE8C060D46B gfd1_yeast mRNA transport factor GFD1 GFD1 YMR255W YM9920.09 Good for full DBP5 activity protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPLESIWADAPDEEPIKKQKPSHKRSNNNKKNNNSRWSNESSSNNKKKDSVNKVKNNKGNHESKTKNKIKETLPREKKPPHSQGKISPVSESLAINPFSQKATEISPPPVSPSKMKTTKTQSKQDTASKMKLLKKKIEEQREILQKTHHKNQQQQVLMDFLNDEGSSNWVDDDEEELILQRLKTSLKI 6C835BD4BD048EB9 zds1_yeast Protein ZDS1 Protein NRC1 RT2GS1 ZDS1 CES1 CKM1 HST1 NRC1 OSS1 STM2 YMR273C YM8156.15C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIESSNKTKQGNYLGIKKGVHSPSRKLNANVLKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSREDDNEENQGDDENEENVDSQRMELDNSKKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTRQKIEKTFANLFRRKPHHKHDASSSPSSSPSSSPSIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLRNRPRPHRHHHSRHGSQKISVKTLKDSQPQQQIPLQPQLEGAIEIEKKEESDSESLPQLQPAVSVSSTKSNSRDREEEEAKKKNKKRSNTTEISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQAPAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKEQQQQQQQQP E5F4C2117DBE1210 E5F4C2117DBE1210 nup42_yeast Nucleoporin NUP42 NUP42 RIP1 UIP1 YDR192C YD9346.04C Nuclear pore protein NUP42 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAFGNPFTSGAKPNLSNTSGINPFTNNAASTNNMGGSAFGRPSFGTANTMTGGTTTSAFGMPQFGTNTGNTGNTSISAFGNTSNAAKPSAFGAPAFGSSAPINVNPPSTTSAFGAPSFGSTGFGAMAATSNPFGKSPGSMGSAFGQPAFGANKTAIPSSSVSNSNNSAFGAASNTPLTTTSPFGSLQQNASQNASSTSSAFGKPTFGAATNTQSPFGTIQNTSTSSGTGVSPFGTFGTNSNNKSPFSNLQSGAGAGSSPFGTTTSKANNNNNVGSSAFGTTNNQSPFSGGSGGTFGSASNLNKNTNGNFQSSFGNKGFSFGITPQNDANKVSQSNPSFGQTMPNTDPNISLKSNGNATSFGFGQQQMNATNVNANTATGKIRFVQGLSSEKDGILELADLAEETLKIFRANKFELGLVPDIPPPPALVA 357F94914A5261F4 357F94914A5261F4 dbp5-gdf1-1 1 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 1 dbp5-zds1-1 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association gfd1-zds1-1 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association gfd1-zds1-2 3 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 2A, 2B dbp5-zds1-2 3 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association Fig 2A gfd1-gfd1-1 3 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig 2B gfd1-dbp5-1 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig 2B nup42-zds1-1 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 2C dbp5-zds1-3 1 4 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Fig 3 gfd1-zds1-3 1 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 3