IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor. Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor. J. Exp. Med. (0022-1007) 2004 imex curation Shiratori I., Ogasawara K., Saito T., Lanier LL., Arase H. arase@faculty.chiba-u.jp 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Shiratori I., Ogasawara K., Saito T., Lanier LL., Arase H. arase@faculty.chiba-u.jp Accepted 2009-NOV-8 by DAVET. J. Exp. Med. (0022-1007) 2004 davet Only protein-protein interactions imex curation pilra_mouse Paired immunoglobulin-like type 2 receptor alpha Pilra Inhibitory receptor PILR-alpha Cell surface receptor FDF03 protein protein mouse Mus musculus Mouse MALLISLPGGTPAMAQILLLLSSACLHAGNSERSNRKNGFGVNQPESCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWRWKDFHGEFIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQTRYFGRVFLQTTEGIQFWQSIPGTQLNVTNATCTPTTLPSTTAATSAHTQNDITEVKSANIGGLDLQTTVGLATAAAVFLVGVLGLIVFLWWKRRRQGQKTKAEIPAREPLETSEKHESVGHEGQCMDPKENPKDNNIVYASISLSSPTSPGTAPNLPVHGNPQEETVYSIVKAK F5F38725B91A3FEC cd99_mouse CD99 antigen Cd99 Pilrl Paired immunoglobin-like type 2 receptor-ligand protein protein mouse Mus musculus Mouse MARAAMEAAATVVLALALLGAAARGAASDDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQGLVPGVVAAVVAAVAGAVSSFVAYQRRRLCFREGGSAPV A309E6E2494FBFE1 pilrb_mouse Paired immunoglobulin-like type 2 receptor beta Pilrb Fdfact Pilrb1 Activating receptor PILR-beta Cell surface receptor FDFACT protein protein mouse Mus musculus Mouse MALLISLPGGTPAMAQVLLLLSSGCLHAGNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLGAMVTMLLAKVLVIVLVYGWMIFLRWKQRPAH 0BB15D5E0A6D08CE pilrb-pilrl 1 3 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait physical association physical association 5C Indeed, when PILR-L was precipitated from cell lysates of PILR-L transfected Ba/F3 cells using PILR-Ig and PILR-Ig, PILR-L was clearly detected as a 17-kD molecule, although PILR-Ig precipitated much less PILR-L. A control Ig did not precipitate the 17-kD protein, and this protein was not immunoprecipitated from untransfected Ba/F3 cells (Fig. 5 C). pilra-pilrl 1 3 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait physical association physical association 5C Indeed, when PILR-L was precipitated from cell lysates of PILR-L transfected Ba/F3 cells using PILR-Ig and PILR-Ig, PILR-L was clearly detected as a 17-kD molecule, although PILR-Ig precipitated much less PILR-L. A control Ig did not precipitate the 17-kD protein, and this protein was not immunoprecipitated from untransfected Ba/F3 cells (Fig. 5 C).