IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Drosophila Topors is a RING finger-containing protein that functions as a ubiquitin-protein isopeptide ligase for the hairy basic helix-loop-helix repressor protein. Drosophila Topors is a RING finger-containing protein that functions as a ubiquitin-protein isopeptide ligase for the hairy basic helix-loop-helix repressor protein. J. Biol. Chem. (0021-9258) 2004 imex curation Secombe J., Parkhurst SM. susanp@fhcrc.org orchard Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Secombe J., Parkhurst SM. susanp@fhcrc.org Accepted 2009-MAY-22 by ORCHARD. J. Biol. Chem. (0021-9258) 2004 orchard Only protein-protein interactions imex curation Drosophila Topors is a RING finger-containing protein that functions as a ubiquitin-protein isopeptide ligase for the hairy basic helix-loop-helix repressor protein. Drosophila Topors is a RING finger-containing protein that functions as a ubiquitin-protein isopeptide ligase for the hairy basic helix-loop-helix repressor protein. J. Biol. Chem. (0021-9258) 2004 imex curation Secombe J., Parkhurst SM. susanp@fhcrc.org orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Secombe J., Parkhurst SM. susanp@fhcrc.org Accepted 2009-MAY-22 by ORCHARD. J. Biol. Chem. (0021-9258) 2004 orchard Only protein-protein interactions imex curation Drosophila Topors is a RING finger-containing protein that functions as a ubiquitin-protein isopeptide ligase for the hairy basic helix-loop-helix repressor protein. Drosophila Topors is a RING finger-containing protein that functions as a ubiquitin-protein isopeptide ligase for the hairy basic helix-loop-helix repressor protein. J. Biol. Chem. (0021-9258) 2004 imex curation Secombe J., Parkhurst SM. susanp@fhcrc.org orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Secombe J., Parkhurst SM. susanp@fhcrc.org Accepted 2009-MAY-22 by ORCHARD. J. Biol. Chem. (0021-9258) 2004 orchard Only protein-protein interactions imex curation hair_drome Protein hairy CG6494 h protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW DIP protein P14003 original sequence version: 142 DIP protein P14003 original sequence version: 109 49BECAF7F2D69FC4 top1_drome DNA topoisomerase 1 DNA topoisomerase I Top1 CG6146 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGDVAAENSIHIQNGGSCEVVQSNGVTTNGHGHHHHHHSSSSSSSKHKSSSKDKHRDREREHKSSNSSSSSKEHKSSSRDKDRHKSSSSSSKHRDKDKERDGSSNSHRSGSSSSHKDKDGSSSSKHKSSSGHHKRSSKDKERRDKDKDRGSSSSSRHKSSSSSRDKERSSSSHKSSSSSSSSKSKHSSSRHSSSSSSKDHPSYDGVFVKPEPVSQQLMHSGSVDAFQMQQLGSYEAAAAGTNFNGNGNVAGANYKNGYEESIVDIKKEEESFNNLSQASSCDYSMSQFRADEPPFVVKHEQSYAEEDSTMNYNDHDDDADEMNDDEEDVPLAMRKRKQEATDRPDGGMDNDDDDDIPLLARKKVKKEKIKKESKEKSKKRVKEEPSDDYGNVKPKKKKMKKEPEPAVSPGKRQKAKAKVEEEEVWRWWEEEKRADGVKWSTLEHKGPVFAPRYERVPRNVRFYYDGKPLELSEETEEAATFYAKMLNHDYCTKEVFNNNFFKDFRKSMTPREREIIKDFRKCNFQEMFNYFQAESEKRKAASKEEKLIKKNENEALMKEFGFCMIDGHKEKIGNFRLEPPGLFRGRGEHPKMGMIKRRIQASDVSINCGKDSKVPSPPPGSRWKEVRHDNTVTWLASWIENVQGQVKYIMLNPSSKLKGEKDHIKYETARRLDKVIDKIRATYRDEWKSKEMRVRQRAVALYFIDKLALRAGNEKDEDQADTVGCCSLRVEHVQLHKELNGKENVVVFDFPGKDSIRYYNEVEVEKRVFKNLELFMEHKKEGDDLFDRLNTQVLNEHLKELMEGLTAKVFRTYNASKTLQSQLDLLTDPSATVPEKLLAYNRANRAVAILCNHQRSVPKSHEKSMENLKEKIKAKREAIEKCESEYHSRDEKKGKQLERLRDQLKKLELQETDRDENKTIALGTSKLNYLDPRISVAWCKKHDVPIEKIFNKTQRTKFLWAVHMADENYRF 3764B8BDEEFA30CD q9n6d8_drome p53 prac Dmel_CG33336 CG10873 CG31325 CG33336 D-p53 DMP53 Dm-P53 DmP53 Dmel\CG33336 Dmp53 Dp53 dmp53 dp53 P53 dmP53 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYISQPMSWHKESTDSEDDSTEVDIKEDIPKTVEVSGSELTTEPMAFLQGLNSGNLMQFSQQSVLREMMLQDIQIQANTLPKLENHNIGGYCFSMVLDEPPKSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCFSNDVSAPVVRCQNHLSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIGRKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEEDEPSKVRRCIAIKTEDTESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGMIKEAAAEVLRNPNQENLRRHANKLLSLKKRAYELP 8389C8FE9B8E6369 esm3_drome Enhancer of split m3 protein E(spl)m3-HLH HLH-m3 HLHm3 CG8346 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNALSETASVSSQESGASEPVWRPW E16D13530FD283C9 esm8_drome Enhancer of split m8 protein E(spl)m8-HLH E(spl) m8 CG8365 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 017B139DE0C328B4 dpn_drome Protein deadpan dpn CG8704 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDYKNDINSDDDFDCSNGYSDSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAPPPGPFAWPGSAAGVAAGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTLPGQTQLPVKNSTSPPLSPISSISSHCEESRAASPTVDVMSKHSFAGVFSTPPPTSAETSFNTSGSLNLSAGSHDSSGCSRPLAHLQQQQVSSTSGIAKRDREAEAESSDCSLDEPSSKKFLAGAIEKSSSAWRPW 9511A6C5F5019A29 toprs_drome E3 ubiquitin-protein ligase Topors Topors dTopors SUMO1-protein E3 ligase Topors Topoisomerase I-binding RING finger protein Topoisomerase I-binding arginine/serine-rich protein CG15104 RING-type E3 ubiquitin transferase Topors protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAEENPGALAANVPYLGVDELGASVIVEPGLEGSNAGGRTLPAAAIKFADLTESGSESGDNEAEEPVSAGPDNANAIGEPGTSASAAEENGTVERNSPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQPFRTIIHNVRTLDDYDRYPVQTTSPVPTENPSLRYHIVRRPRYTPLVQNQAVIVNDIEAAIAAGAAGEDVLSAAEVAAGRRSYSRFEPYRSELMNYYQHDQDASTSGSLSQLWRRYVYDRKLYALPVSDSVTGHFREWSARFYRNNPAQIHRLMPWIHRDIMCLLRNAAHSVNTVMTLMSDLLPMTSLLGPTFRRRLSPYLGERTSHFIHELFNFARSPYDINGYDHVVQYSARVAEEVEVDLLDMVETQSSNGDDLNLEVGDSDADAINAGFSPDWSPPRVRPSTSVIVTNPGATHSFSVTMASDGSELPGISIRRTTNVGSQTVAINLSMRRPAAVASEEPEVIEIDDGDAAANAEVAAINDGSNTSRRHAGATLPVTAHIELESSSSSGDEDECVFVLELKPPHMRTPEQVSLDSNSDSDVVFVNEQHEAAPDAIAENRSTQSPLDLASRDQGLFMGPSTSGAAANRGKNWKLVMAQTRRLDQLRTLRSIRSKKSRRSSMPARSDSGSSPSSCSSSSFHFSSSSDEDSSDSSTTNSEPPKKKSRKRVANNKRSKKESIGKRTSRKRKAKDQNMEMLEQQQISQKKPQRQPESSSDSPSSSDDESGGDSSESSGQPNTNNNKSSSDSDDDSAVNMQLSALRATLKAEATLEDRKPVKLELQLPDDDQAGPLHSRMTPSPREDNEPGCSAPKRRRSCSHSNQSSQSASLASSSTATSSSAPLSSFAWGAAGFSGDPLMRGHPAMEEHDIANSLIELSTLTQPVNIGLFNEHYNSAENSMGMLSNTLCDSPQTLAADDANLENYFDTDADPEASRERDAYSLEAAIDVVGESELQIAEDTATATEEQDEEDEEDEDQEEDDQEEEKAAEEEEEEEEDDDDSDNHDENDENQGLLPY BEB3E63AA131E9E8 hairy-topors 1 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined basic region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 1A, 3A, 3B One of these cDNAs (CG15104) encodes a 1038-amino acid protein that interacts with Hairy in a GST pull-down assay using in vitro translated 35S-labeled protein (Fig. 1A; see Fig. 3, A and B). topors-topo_1 1 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A topors-dmp53 1 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A hairy-topors-1 2 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B In addition, recombinant His6-tagged CG15104 bound to GST-Hairy in vitro (Fig. 1B), demonstrating that this interaction is direct. hairy-topors-2 3 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region gal4 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C As shown in Fig. 1C, immunoprecipitation of Hairy using anti-Myc epitope antibody 9E10 and subsequent Western blotting with anti-Gal4 antibody showed the association of Hairy and CG15104 specifically when antibody 9E10 was present and both Gal4-CG15104 and Myc-Hairy were transfected into cells. hairy-topors-3 1 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A, 3A, 3C, 3D One of these cDNAs (CG15104) encodes a 1038-amino acid protein that interacts with Hairy in a GST pull-down assay using in vitro translated 35S-labeled protein (Fig. 1A; see Fig. 3, A and B). hairy-hairy 1 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 3C Hairy did not bind GST (lane 8), but could homodimerize (lane 9) and heterodimerize with GST-E(spl)m3 (lane 10), GST-E(spl)m8 (lane 11), and GST-Deadpan (lane 12). hairy-m8 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 3C Hairy did not bind GST (lane 8), but could homodimerize (lane 9) and heterodimerize with GST-E(spl)m3 (lane 10), GST-E(spl)m8 (lane 11), and GST-Deadpan (lane 12). hairy-m3 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 3C Hairy did not bind GST (lane 8), but could homodimerize (lane 9) and heterodimerize with GST-E(spl)m3 (lane 10), GST-E(spl)m8 (lane 11), and GST-Deadpan (lane 12). hairy-dpn 1 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C Hairy did not bind GST (lane 8), but could homodimerize (lane 9) and heterodimerize with GST-E(spl)m3 (lane 10), GST-E(spl)m8 (lane 11), and GST-Deadpan (lane 12).