UniProt UniProt http://www.uniprot.org Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. J. Cell Biol. (0021-9525) 2004 imex curation Hofken T., Schiebel E. eschiebel@picr.man.ac.uk 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hofken T., Schiebel E. eschiebel@picr.man.ac.uk Accepted 2009-FEB-13 by ORCHARD. 03-Mar-2009: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2004 orchard Only protein-protein interactions imex curation Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. J. Cell Biol. (0021-9525) 2004 imex curation Hofken T., Schiebel E. eschiebel@picr.man.ac.uk 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hofken T., Schiebel E. eschiebel@picr.man.ac.uk Accepted 2009-FEB-13 by ORCHARD. 03-Feb-2009: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2004 orchard Only protein-protein interactions imex curation Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. J. Cell Biol. (0021-9525) 2004 imex curation Hofken T., Schiebel E. eschiebel@picr.man.ac.uk 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hofken T., Schiebel E. eschiebel@picr.man.ac.uk Accepted 2009-FEB-13 by ORCHARD. 03-Feb-2009: Contacted by JYOTI. J. Cell Biol. (0021-9525) 2004 orchard Only protein-protein interactions imex curation bfa1_yeast Mitotic check point protein BFA1 Cell cycle arrest protein BFA1 BFA1 YJR053W J1667 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIRPLTLNGLDEPETSFEELNTTLPRFQSHETLTLEENVPPLSTSTYIPPPSSVGTSDTGTVFSNSTSAFWSNKQADDDQDMEVDQDDEFLNDFQEFQNKKDDFDDAIKTNFHLRNGCRTGPFKNDIFAEEFDRKLSLEDKPRLKQPRSMMELKPKRKLSNSVTSRNLRSGNSVRFKKSMPNLALVNPAIREEEEDEEREREDQREFNYKIDNDTQDTILAKFSSDDEGDFLTGFEELEGEAIDETISSNDKESADHPRFLKKSSSSLPLKISPAQYDIVKHDELLTPGLHRRQRDWNTQQELDSFKEKRSVRHCSNQNVQLNGPAKIKTIKQQIDHNTPMKKGSMIYNPKTMKWEGNENVLSKFSDVDTANRKALLIKNKLQRDADSKKQKYSDLQHARATSRNQKVIGNMILDEQNLRWVSVSEEEADPFAGIPEINLPPVGKSMKKRSSSPFLRSKSQVNTPFVSNDNDGVYQSTAAQARLRKYHSMRTLNGTTETPEISSTFHLSSRALEKFYHEENRWCKKLASWFIPRDETIISVDEETIMDESTVNSKRKSYMYEIRNMVINSTKD 1EA75D26FCF041DA 1EA75D26FCF041DA cdc14_yeast Tyrosine-protein phosphatase CDC14 CDC14 OAF3 YFR028C protein protein yeast Saccharomyces cerevisiae Baker's yeast MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYRFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLISLEEYRLQKKKLKDDKRVAQNNIEGELRDLTMTPPSNGHGALSARNSSQPSTANNGSNSFKSSAVPQTSPGQPRKGQNGSNTIEDINNNRNPTSHANRKVVIESNNSDDESMQDTNGTSNHYPKVSRKKNDISSASSSRMEDNEPSATNINNAADDTILRQLLPKNRRVTSGRRTTSAAGGIRKISGSIKK 4EB3985DFA3FD823 4EB3985DFA3FD823 tem1_yeast Protein TEM1 YML064C TEM1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT F650C8946A03707C F650C8946A03707C net1_yeast Nucleolar protein NET1 YJL076W J1038 NET1 CFI1 ESC5 SRM8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQSVQPQQQIPSSSGVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIMSTMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYLENGENYESDDSSSSENQETPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQVREKEDTNDKLLEKEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEVDTTVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKDIDNSKPDPRNILPQRTPRSAAKRAAQLLAGAKKNEVPQKSTEDSSSAASTDDESESGIETDFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINKEVDEERNDKRDSQKKSAVSESSVTNSKISEQMAKSFYPNSNKKQNEATKVETKPATQASSFPVVGGSPSVATKGTTSFNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSANIGGEDLNKKAEGSKEPEKASANIQDANDKNNSKEKEDSKSKQVSQKKLKMTDHLKEGNVQLPKPSANDKLKDLKAKFTNSKTLVPPGIISNEKNNSSANDDDSSSSGSSTEDESSSSSSSSDEETSTSRKARRVVVNTPREPVRSSSKIEAPSPSVNKKINATPDKIPVTQLMDMSSPPSVKSKTTSNPSSILHDLPRKVRPSLSSLSDLVSRGIPDVKEKTSKSNEKSQTKAPSSSDDESSSDSDSNSSSDSVSDSSSDSKSESDSDDSGDSSDDGKSFISAKSASAALGKKKKPSGGFASLIKDFKKK 80EDF9A8065EB5A2 80EDF9A8065EB5A2 cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C 30BD644BA9836B2C bub2_yeast Mitotic check point protein BUB2 BUB2 YMR055C YM9796.08C Cell cycle arrest protein BUB2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSIEDLISNPPLLLHSSLSQLRYLILSEGLPISEDKQQQRTRCYVWTVLSQTSMEASTQRYLALLKLGPPSTTIYQKIKNDTSRTFQTDPNFRNRVSEDALIRCLSCFAWQTQQRRQKTRFGRIPVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKLLDISLRIIDPKLSKFLSDNLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAYGFHMNILFVVAFLVKMRSKVFKSDSPVNLLRQFPDFDADEIIRLGVGFIAKIPAQIYDLLVDHLTDPDIYIP A1DDBFB548E81EA3 A1DDBFB548E81EA3 gic1_yeast GTPase-interacting component 1 YHR061C GIC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEGKRLQQMELPQMKSIWIDEDQEMEKLYGFQVRQRFMNGPSTDSDEDADEDLGIVLVDSKKLALPNKNNIKLPPLPNYMTINPNINSNHKSLTNKKKNFLGMFKKKDLLSRRHGSAKTAKQSSISTPFDFHHISHANGKREDNPLESHEEKHDVESLVKFTSLAPQPRPDSNVSSKYSNVVMNDSSRIVSSSTIATTMDSHHDGNETNNTPNGNKQLDSPTDLEMTLEDLRNYTFPSVLGDSVSEKTNPSSPSVSSFSGKFKPRELSALHTPELGNCFNVDQSLNSPGNRISVDDVLKFYYQCSETSTPRNT C6B2FE253799500B gic1-cdc42-1 1 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 3A gic1-bfa1-1 1 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 3A gic1-cdc14-1 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 3A bub2-gic1-1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig 3A gic1-cdc14-2 2 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 3B, S1B Interaction is inhibited by NET1. gic1-bfa1-2 2 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 3B gic1-bub2-2 2 9 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 3B gic1-tem1-1 2 6 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Fig 3B bub2-tem1-1 2 6 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 4A, 4G Interaction is inhibited by GST-GIC1. bfa1-tem1-1 2 6 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Fig 4B Interaction is inhibited by GST-GIC1. bfa1-bub2-1 2 9 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig 4C Interaction is inhibited by GST-GIC1. bub2-tem1-2 3 6 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 4D Interaction is inhibited by GIC1. net1-cdc14-1 2 5 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig S1B