UniProt UniProt http://www.uniprot.org Kinetochore recruitment of two nucleolar proteins is required for homolog segregation in meiosis I. Kinetochore recruitment of two nucleolar proteins is required for homolog segregation in meiosis I. Dev. Cell (1534-5807) 2003 imex curation Rabitsch KP., Petronczki M., Javerzat JP., Genier S., Chwalla B., Schleiffer A., Tanaka TU., Nasmyth K. nasmyth@nt.imp.univie.ac.at 09-April-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Rabitsch KP., Petronczki M., Javerzat JP., Genier S., Chwalla B., Schleiffer A., Tanaka TU., Nasmyth K. nasmyth@nt.imp.univie.ac.at Accepted 2009-FEB-26 by JYOTI. 09-April-2009: Contacted by JYOTI. Dev. Cell (1534-5807) 2003 jyoti Only protein-protein interactions imex curation Kinetochore recruitment of two nucleolar proteins is required for homolog segregation in meiosis I. Kinetochore recruitment of two nucleolar proteins is required for homolog segregation in meiosis I. Dev. Cell (1534-5807) 2003 imex curation Rabitsch KP., Petronczki M., Javerzat JP., Genier S., Chwalla B., Schleiffer A., Tanaka TU., Nasmyth K. nasmyth@nt.imp.univie.ac.at 09-April-2009: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Rabitsch KP., Petronczki M., Javerzat JP., Genier S., Chwalla B., Schleiffer A., Tanaka TU., Nasmyth K. nasmyth@nt.imp.univie.ac.at Accepted 2009-FEB-26 by JYOTI. 09-April-2009: Contacted by JYOTI. Dev. Cell (1534-5807) 2003 jyoti Only protein-protein interactions imex curation Kinetochore recruitment of two nucleolar proteins is required for homolog segregation in meiosis I. Kinetochore recruitment of two nucleolar proteins is required for homolog segregation in meiosis I. Dev. Cell (1534-5807) 2003 imex curation Rabitsch KP., Petronczki M., Javerzat JP., Genier S., Chwalla B., Schleiffer A., Tanaka TU., Nasmyth K. nasmyth@nt.imp.univie.ac.at 09-April-2009: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rabitsch KP., Petronczki M., Javerzat JP., Genier S., Chwalla B., Schleiffer A., Tanaka TU., Nasmyth K. nasmyth@nt.imp.univie.ac.at Accepted 2009-FEB-26 by JYOTI. 09-April-2009: Contacted by JYOTI. Dev. Cell (1534-5807) 2003 jyoti Only protein-protein interactions imex curation fbrl_yeast rRNA 2'-O-methyltransferase fibrillarin NOP1 LOT3 YDL014W D2870 U3 small nucleolar RNA-associated protein NOP1 Histone-glutamine methyltransferase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK 56A8B958A7B6066E 56A8B958A7B6066E cbf3a_yeast Centromere DNA-binding protein complex CBF3 subunit A CEP2 CTF14 YGR140W CBF2 CBF3A NDC10 Chromosome transmission fidelity protein 14 Kinetochore protein CTF14 Centromere-binding factor 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSSILFLLKLMKIMDVQQQQEAMSSEDRFQELVDSLKPRTAHQYKTYYTKYIQWCQLNQIIPTPEDNSVNSVPYKDLPISAELIHWFLLDTLITDDKPGEKREETEDLDEEEENSFKIATLKKIIGSLNFLSKLCKVHENPNANIDTKYLESVTKLHTHWIDSQKAITTNETNNTNTQVLCPPLLKVSLNLWNPETNHLSEKFFKTCSEKLRFLVDFQLRSYLNLSFEERSKIRFGSLKLGKRDRDAIIYHKVTHSAEKKDTPGHHQLLALLPQDCPFICPQTTLAAYLYLRFYGIPSVSKGDGFPNLNADENGSLLQDIPILRGKSLTTYPREETFSNYYTTVFRYCHLPYKRREYFNKCNLVYPTWDEDTFRTFFNEENHGNWLEQPEAFAFPDKIPFDFKKIMNFKSPYTSYSTNAKKDPFPPPKDLLVQIFPEIDEYKRHDYEGLSQNSRDFLDLMEVLRERFLSNLPWIYKFFPNHDIFQDPIFGNSDFQSYFNDKTIHSKGSPILSFDILPGFNKIYKNKTNFYSLLIERPSQLTFASSHNPDTHPTQKQESEGPLQMSQLDTTQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEMKKSSRGYILHQLNLFKITLDERIKKSKIDDADKFIRDNQPIKKEENIVNEDGPNTSRRTKRPKQIRLLSIADSSDESSTEDSNVFKKDGESIEDGAYGENEDENDSEMQEQLKSMINELINSKISTFLRDQMDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDMEVPKKLRTSGKYAETVKDNDDHQAMSTTASPSPEQDQEAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSMNKSGNKSWRANCEALYKERKSIVEFYIYLVNHESLDRYKAVDICEKLRDQNEGSFSRLAKFLRKWRHDHQNSFDGLLVYLSN C93FB7E033931E3D csm1_yeast Monopolin complex subunit CSM1 YCR086W YCR86W Chromosome segregation in meiosis protein 1 CSM1 SPO86 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLNKKREKKDETE 9650E0DA89B31CC5 9650E0DA89B31CC5 mam1_yeast Monopolin complex subunit MAM1 YER106W MAM1 Monopolar microtubule attachment during meiosis 1 protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MREKRTISNKDTNYLKFPNKLQRYSRFLSRKISNTSPEKQPKKNIKEHCLSSYHKEHSVKPKQNSGNVAAKEDKDTQHLQNNVANEEATECLTRSNLKKLQEKIFDRELNDIACDHCLCSTENRRDIKYSRLWFLFELEMSENWNENLRLSCYNKYVYSAIDESWKMENILLKEQEKHYEYFPIGQLLIPNNIDYTNKQKRKENIEDLTIEIDSIIETNHQKKRFLPQSVLIKREDEIAFDDFHLDARKVLNDLSATSENPFSSSPNTKKIKSKGKTLEVVPKKKNKKIIGALERKLHIDEN 64E467A38EB831FF lrs4_yeast Monopolin complex subunit LRS4 Loss of rDNA silencing protein 4 LRS4 D9461.25 YDR439W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTLLQLLSNYYKAKLDSERIYNEYVQSQYEFASLDKLNNNKGDPKKVVDETLFLQRQIAQLNKQLQLSFQENEKLLSVQKNQKALYQSKLSSKDAFIDDLKLKLKVEQISVDKHNKERTPSTGRDEQQRNSKAAHTSKPTIHLLSPIVNRDKPNNQTNDRGGNDPDSPTSQRRSRGLRSLLSSGKNTIFDSISKNLDDEINENAHIRNDTTSSKIAGKSPSRLSALQKSPELRKERNNMILKEHILRSKDDQNITSSRKLDNIELSSIGDSTAMTSRSSTVNANDILGNEENDGITKLKRVNKLTSSPVKRDCSTNKKRKLTKQRIATLPNSDEELSNNLNVDEFV 60D880BA947B9005 60D880BA947B9005 nop1-csm1-1 2 6 unspecified role unspecified role neutral component neutral component c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1B, 4A Colocalization requires LRS4. nop1-lrs4-1 2 4 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig 1C, 4A Colocalization requires CSM1. cbf2-lrs4-1 2 8 unspecified role unspecified role neutral component neutral component c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig 4C cbf2-csm1-1 2 6 unspecified role unspecified role neutral component neutral component c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig 4B csm1-lrs4-1 3 8 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 5A csm1-lrs4-2 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig 5B lrs4-csm1-4 1 8 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig 5C mam1-csm1-4 1 7 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig 5D mam1-lrs4-1 1 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig 5E