IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities. Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities. J. Biol. Chem. (0021-9258) 2003 imex curation El Alami M., Dubois E., Oudjama Y., Tricot C., Wouters J., Stalon V., Messenguy F. Gel Filtration on the Superdex 200 Column. Presence of participants determined by enzyme assay. fanarg@ulb.ac.be davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined El Alami M., Dubois E., Oudjama Y., Tricot C., Wouters J., Stalon V., Messenguy F. Gel Filtration on the Superdex 200 Column. Presence of participants determined by enzyme assay. fanarg@ulb.ac.be Accepted 2009-AUG-6 by DAVET. J. Biol. Chem. (0021-9258) 2003 davet Only protein-protein interactions imex curation Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities. Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities. J. Biol. Chem. (0021-9258) 2003 imex curation El Alami M., Dubois E., Oudjama Y., Tricot C., Wouters J., Stalon V., Messenguy F. Gel Filtration on the Superdex 200 Column. Presence of participants determined by enzyme assay. fanarg@ulb.ac.be davet Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined El Alami M., Dubois E., Oudjama Y., Tricot C., Wouters J., Stalon V., Messenguy F. Gel Filtration on the Superdex 200 Column. Presence of participants determined by enzyme assay. fanarg@ulb.ac.be Accepted 2009-AUG-6 by DAVET. J. Biol. Chem. (0021-9258) 2003 davet Only protein-protein interactions imex curation Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities. Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities. J. Biol. Chem. (0021-9258) 2003 imex curation El Alami M., Dubois E., Oudjama Y., Tricot C., Wouters J., Stalon V., Messenguy F. Gel Filtration on the Superdex 200 Column. Presence of participants determined by enzyme assay. fanarg@ulb.ac.be davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast reverse two hybrid reverse two hybrid predetermined predetermined participant predetermined El Alami M., Dubois E., Oudjama Y., Tricot C., Wouters J., Stalon V., Messenguy F. Gel Filtration on the Superdex 200 Column. Presence of participants determined by enzyme assay. fanarg@ulb.ac.be Accepted 2009-AUG-6 by DAVET. J. Biol. Chem. (0021-9258) 2003 davet Only protein-protein interactions imex curation ornithine Ornithine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) otc_yeast Ornithine carbamoyltransferase ARG3 YJL088W J0924 Ornithine transcarbamylase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTTASTPSSLRHLISIKDLSDEEFRILVQRAQHFKNVFKANKTNDFQSNHLKLLGRTIALIFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVNKHEDILAFCKDSSVPIINSLCDKFHPLQAICDLLTIIENFNISLDEVNKGINSKLKMAWIGDANNVINDMCIACLKFGISVSISTPPGIEMDSDIVDEAKKVAERNGATFELTHDSLKASTNANILVTDTFVSMGEEFAKQAKLKQFKGFQINQELVSVADPNYKFMHCLPRHQEEVSDDVFYGEHSIVFEEAENRLYAAMSAIDIFVNNKGNFKDLK 6EBB6598FA93C59E 6EBB6598FA93C59E carbamoyl phosphate Carbamoyl phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) argi_yeast Arginase CAR1 LPH15W YPL111W protein protein yeast Saccharomyces cerevisiae Baker's yeast METGPHYNYYKNRELSIVLAPFSGGQGKLGVEKGPKYMLKHGLQTSIEDLGWSTELEPSMDEAQFVGKLKMEKDSTTGGSSVMIDGVKAKRADLVGEATKLVYNSVSKVVQANRFPLTLGGDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNKDVPHCPESLKWVPGNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKAVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARCALGETLL A5979DC9F1FDFF2E A5979DC9F1FDFF2E arg3-car1-1 3 5 unspecified role unspecified role bait bait P05150:p.Asp182Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:12:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp182asn' Tue Jun 30 20:23:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp182Asn' 7 unspecified role unspecified role prey prey physical association physical association We first tested whether OTCase and arginase do interact in vivo using the two-hybrid assay Fig. 1 arg3-ch4no5p-1 2 6 enzyme target enzyme target substrate substrate neutral component neutral component 4 enzyme target enzyme target substrate substrate neutral component neutral component 5 enzyme enzyme neutral component neutral component P05150:p.Leu290Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L S Wed May 02 19:44:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu290ser' Tue Jun 30 20:16:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu290Ser' P05150:p.Leu290Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Wed May 02 17:53:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu290gln' Tue Jun 30 15:54:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu290Gln' P05150:p.Gly181Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 20:06:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly181arg' Tue Jun 30 20:07:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly181Arg' P05150:p.Asp182Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 15:41:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp182asn' Tue Jun 30 17:54:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp182Asn' P05150:p.Asn184Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N Q Wed May 02 16:48:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn184gln' Tue Jun 30 15:55:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn184Gln' undefined mutation cys191met_cys194asn_phe197val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:36:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'cys191_cys194_phe197' P05150:p.Glu256Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 15:35:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu256gln' Tue Jun 30 17:58:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu256Gln' P05150:p.Glu256Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:17:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu256ala' Tue Jun 30 16:19:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu256Ala' P05150:p.Lys263Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:48:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys263arg' Tue Jun 30 16:20:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys263Arg' P05150:p.Lys263Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:37:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys263ala' Tue Jun 30 18:57:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys263Ala' P05150:p.Lys265Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:34:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys265ala' Tue Jun 30 17:41:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys265Ala' P05150:p.Cys289Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:32:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys289ser' Tue Jun 30 18:37:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys289Ser' P05150:p.Thr68Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T G Wed May 02 14:53:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr68gly' Tue Jun 30 18:02:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr68Gly' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction In vitro inhibition of wild type OTCase and mutated OTCase-D182N by wild type arginase. Fig. 2, Table 1 Mutations of putative ornithine binding residues, Asp-182, Asn-184, Asn-185, Cys-289, and Glu-256 greatly reduced the affinity for ornithine arg3-ch4no5p-2 2 6 enzyme target enzyme target substrate substrate neutral component neutral component 7 inhibitor inhibitor neutral component neutral component yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 enzyme enzyme neutral component neutral component P05150:p.Asp182Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 20:00:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp182asn' Tue Jun 30 20:19:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp182Asn' P05150:p.Asn184Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N Q Wed May 02 18:40:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn184gln' Tue Jun 30 16:19:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn184Gln' P05150:p.Glu256Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 15:09:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu256gln' Tue Jun 30 17:50:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu256Gln' P05150:p.Glu256Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 14:45:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu256ala' Tue Jun 30 18:37:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu256Ala' P05150:p.Lys263Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:43:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys263ala' Tue Jun 30 19:20:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys263Ala' P05150:p.Lys263Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:42:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys263arg' Tue Jun 30 18:26:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys263Arg' P05150:p.Cys289Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:57:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys289ser' Tue Jun 30 19:49:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys289Ser' P05150:p.Asn185Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N Q Wed May 02 14:32:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn185gln' Tue Jun 30 18:11:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn185Gln' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 enzyme target enzyme target substrate substrate neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction In vitro inhibition of wild type OTCase and mutated OTCase-D182N by wild type arginase. Figs. 2 and 5, Table 1 Mutations inhibit CAR1 binding to ARG3 and thus prevent the inhibition of ornithine carbamoyltransferase activity. arg3-car1-2 1 7 unspecified role unspecified role neutral component neutral component P00812:p.[Cys321Arg;Cys326Thr] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C R certain certain sequence position certain certain certain sequence position certain C T Wed May 02 14:45:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys321arg,cys326thr' Tue Jun 30 18:28:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys321Arg;Cys326Thr]' 5 unspecified role unspecified role neutral component neutral component P05150:p.Asp182Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:22:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp182asn' Tue Jun 30 18:59:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp182Asn' physical association physical association Moreover, OTCase-D182N had lost the capacity to interact with arginase, as shown by molecular sieving (Fig. 3). Figs. 3, 7B and 7C arg3-ch4no5p-3 2 7 inhibitor inhibitor neutral component neutral component P00812:p.[Cys321Arg;Cys326Thr] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C R certain certain sequence position certain certain certain sequence position certain C T Wed May 02 17:07:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys321arg,cys326thr' Tue Jun 30 19:08:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys321Arg;Cys326Thr]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 enzyme target enzyme target substrate substrate neutral component neutral component 5 enzyme enzyme neutral component neutral component yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 enzyme target enzyme target substrate substrate neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Replacing the two cysteines completely abolished the regulatory function of arginase, which had lost the capacity to bind and inhibit OTCase. Fig. 7, Table 2 Mutations inhibit CAR1 binding to ARG3 and thus prevent the inhibition of ornithine carbamoyltransferase activity.