IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel phospholipid-binding protein from the yeast Saccharomyces cerevisiae with dual binding specificities for the transport GTPase Ypt7p and the Sec1-related Vps33p. A novel phospholipid-binding protein from the yeast Saccharomyces cerevisiae with dual binding specificities for the transport GTPase Ypt7p and the Sec1-related Vps33p. Eur. J. Cell Biol. (0171-9335) 2002 imex curation Lazar T., Scheglmann D., Gallwitz D. Dieter.Gallwitz@mpi-bpc.mpg.de 09-April-2009: Contacted by JYOTI. Yeast cDNA. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lazar T., Scheglmann D., Gallwitz D. Dieter.Gallwitz@mpi-bpc.mpg.de Accepted 2009-MAR-19 by ORCHARD. 09-April-2009: Contacted by JYOTI. Yeast cDNA. Eur. J. Cell Biol. (0171-9335) 2002 orchard Only protein-protein interactions imex curation A novel phospholipid-binding protein from the yeast Saccharomyces cerevisiae with dual binding specificities for the transport GTPase Ypt7p and the Sec1-related Vps33p. A novel phospholipid-binding protein from the yeast Saccharomyces cerevisiae with dual binding specificities for the transport GTPase Ypt7p and the Sec1-related Vps33p. Eur. J. Cell Biol. (0171-9335) 2002 imex curation Lazar T., Scheglmann D., Gallwitz D. Dieter.Gallwitz@mpi-bpc.mpg.de 09-April-2009: Contacted by JYOTI. Yeast cDNA. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lazar T., Scheglmann D., Gallwitz D. Dieter.Gallwitz@mpi-bpc.mpg.de Accepted 2009-MAR-19 by ORCHARD. 09-April-2009: Contacted by JYOTI. Yeast cDNA. Eur. J. Cell Biol. (0171-9335) 2002 orchard Only protein-protein interactions imex curation A novel phospholipid-binding protein from the yeast Saccharomyces cerevisiae with dual binding specificities for the transport GTPase Ypt7p and the Sec1-related Vps33p. A novel phospholipid-binding protein from the yeast Saccharomyces cerevisiae with dual binding specificities for the transport GTPase Ypt7p and the Sec1-related Vps33p. Eur. J. Cell Biol. (0171-9335) 2002 imex curation Lazar T., Scheglmann D., Gallwitz D. Dieter.Gallwitz@mpi-bpc.mpg.de 09-April-2009: Contacted by JYOTI. Yeast cDNA. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lazar T., Scheglmann D., Gallwitz D. Dieter.Gallwitz@mpi-bpc.mpg.de Accepted 2009-MAR-19 by ORCHARD. 09-April-2009: Contacted by JYOTI. Yeast cDNA. Eur. J. Cell Biol. (0171-9335) 2002 orchard Only protein-protein interactions imex curation vps45_yeast Vacuolar protein sorting-associated protein 45 VPS45 STT10 VPL28 YGL095C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNLFDVADFYINKIVTSQSKLSVANVNEHQRIKVLLLDKNTTPTISLCATQSELLKHEIYLVERIENEQREVSRHLRCLVYVKPTEETLQHLLRELRNPRYGEYQIFFSNIVSKSQLERLAESDDLEAVTKVEEIFQDFFILNQDLFSFDLQPREFLSNKLVWSEGGLTKCTNSLVSVLLSLKIKPDIRYEGASKICERLAKEVSYEIGKNERTFFDFPVMDSTPVLLILDRNTDPITPLLQPWTYQSMINEYIGIKRNIVDLSKVPRIDKDLEKVTLSSKQDAFFRDTMYLNFGELGDKVKQYVTTYKDKTQTNSQINSIEDIKNFIEKYPEFRKLSGNVAKHMAIVGELDRQLKIKNIWEISEIEQNLSAHDANEEDFSDLIKLLQNEAVDKYYKLKLACIYSLNNQTSSDKIRQLVEILSQQLPPEDVNFFHKFKSLFSRQDKMTQSNHDKDDILTELARRFNSRMNSKSNTAENVYMQHIPEISSLLTDLSKNALFRDRFKEIDTQGHRVIGNQQSKDIPQDVILFVIGGVTYEEARLVHDFNGTMNNRMRVVLGGTSILSTKEYMDSIRSAK 4AA50D568228228F 4AA50D568228228F vps33_yeast Vacuolar protein sorting-associated protein 33 VPS33 SLP1 Protein SLP1 Vacuolar morphogenesis protein 5 VAM5 L8084.15 YLR396C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRFWNTKKFSLTNADGLCATLNEISQNDEVLVVQPSVLPVLNSLLTFQDLTQSTPVRKITLLDDQLSDDLPSALGSVPQMDLIFLIDVRTSLRLPPQLLDAAQKHNLSSLHIIYCRWKPSFQNTLEDTEQWQKDGFDLNSKKTHFPNVIESQLKELSNEYTLYPWDLLPFPQIDENVLLTHSLYNMENVNMYYPNLRSLQSATESILVDDMVNSLQSLIFETNSIITNVVSIGNLSKRCSHLLKKRIDEHQTENDLFIKGTLYGERTNCGLEMDLIILERNTDPITPLLTQLTYAGILDDLYEFNSGIKIKEKDMNFNYKEDKIWNDLKFLNFGSIGPQLNKLAKELQTQYDTRHKAESVHEIKEFVDSLGSLQQRQAFLKNHTTLSSDVLKVVETEEYGSFNKILELELEILMGNTLNNDIEDIILELQYQYEVDQKKILRLICLLSLCKNSLREKDYEYLRTFMIDSWGIEKCFQLESLAELGFFTSKTGKTDLHITTSKSTRLQKEYRYISQWFNTVPIEDEHAADKITNENDDFSEATFAYSGVVPLTMRLVQMLYDRSILFHNYSSQQPFILSREPRVSQTEDLIEQLYGDSHAIEESIWVPGTITKKINASIKSNNRRSIDGSNGTFHAAEDIALVVFLGGVTMGEIAIMKHLQKILGKKGINKRFIIIADGLINGTRIMNSIS ED78DF55109C20E7 ED78DF55109C20E7 ypt7_yeast Ypt/Rab-type GTPase YPT7 YPT7 VAM4 Vacuolar morphology protein 4 YM8270.02 YML001W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAINIRLDGENNSCSC 0E2B72BDA7F7CEE5 0E2B72BDA7F7CEE5 pep7_yeast Vacuolar segregation protein PEP7 PEP7 VAC1 Protein VAC1 Vacuolar protein sorting-associated protein 19 Vacuolar protein-targeting protein 19 Carboxypeptidase Y-deficient protein 7 VPL21 VPS19 VPT19 YDR323C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLENVSCPICLRKFDNLQALNAHLDVEHGFNDNEDSLGSNDSRLVNGKQKKARSVDSSAQKLKRSHWEKFKKGKSCCHTCGRTLNNNIGAINCRKCGKLYCRRHLPNMIKLNLSAQYDPRNGKWYNCCHDCFVTKPGYNDYGEVIDLTPEFFKVRNIKREDKNLRLLQLENRFVRLVDGLITLYNTYSRSIIHNLKMNSEMSKLERTVTPWRDDRSVLFCNICSEPFGLLLRKHHCRLCGMVVCDDANRNCSNEISIGYLMSAASDLPFEYNIQKDDLLHIPISIRLCSHCIDMLFIGRKFNKDVRMPLSGIFAKYDSMQNISKVIDSLLPIFEDSLNSLKVETAKDSENTLDPKNLNDLARLRHKLLNSFNLYNTLTRQLLSVEPQSHLERQLQNSIKIASAAYINEKILPLKSLPAILNPEGHKTNEDGQKAEPEVKKLSQLMIENLTIKEVKELREELMVLKEQSYLIESTIQDYKKQRRLEEIVTLNKNLEELHSRIHTVQSKLGDHGFN 53C304F1ADA5B7A1 53C304F1ADA5B7A1 ivy1_yeast Protein IVY1 IVY1 Interaction with VPS33 and YPT7 protein 1 YDR229W YD9934.14 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPDNNTEQLQGSPSSDQRLRVDWDNGNHFDVSPDRYAPHLSEFYPIVNSKRPVASSAGSENNDHLDDMNHLRSSKVYSKARRASSITSGTSTINDLQTLITKRDVKETQEALSTLLRNSNAYSDSLLKTSQNGAEIAHSLENIAKLKGCNDETAEKLLSASGLFYLLSNHQLIMSKYFNDLLGDNLIDDIDEFELQTKIMENKFKAQSKEQSLKLKLQERHNFDISKRKIRNLISYRESLSSLQARLDQLETLKHDFYMDSYELVENTCNKVLSKVATVSRAQVEISENIARKGWSGGGLDELLCDADDPFSKKADGPYGTIGGDGETAGEAYNSDEETGGNDVVLNELLEGTSQPSTSKTSLPKSKGSSTVSTPNHSQSSSNKDGVRNNGGGKNGEDEDTDNLMGTENSFSLPPTRNSAEETTQTFKQLSIKEDNDNHSSDTDGMQDQSSNI 2DB24DD88BED4522 2DB24DD88BED4522 ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B F8C704F6BF2D227B ypt6_yeast GTP-binding protein YPT6 L8479.11 YLR262C YPT6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC A8E6211FF24FAE0B A8E6211FF24FAE0B ivy1-ypt7 1 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 3a Ivy1p (tagged with C-terminal HA-epitopes) interacts with bacterially produced recombinant GST-Ypt7p and GST-Ypt7(T22N)p but not with unmodified GST. ivy1-ypt6 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 3c A small amount of Ivy1- HAp (compared to GST-Ypt7p) is found attached to GST-Ypt6p. ivy1-vps33 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 3c Ivy1-HAp is found on washed Sepharose matrices containing GST-Ypt7p, GST-Vps33p and GST-Ivy1p. ivy1-ivy1 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 3c Ivy1-HAp is found on washed Sepharose matrices containing GST-Ypt7p, GST-Vps33p and GST-Ivy1p. ivy1-vps33-1 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey region vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 3d VSV-tagged Vps33p binds to GST-Ivy1p but not to GSTalone. vac1-vps45 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 3e Vps45-HAp binds to Vac1p (as described by Tall et al., 1999) but not to GST or GST-Ivy1p, confirming the specificity for Vps33p of Ivy1p. Vac1 is a synonym for the official name PEP7. ivy1-ypt7-2 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 2 Two-hybrid system interactions of Ivy1p. Ivy1p yields positive lacZ assay results with the transport GTPase Ypt7p (wild-type), the mutant GTPases Ypt7(T22N)p (predominantly in the GDP-bound form) and Ypt7(Q68L)p (predominantly in the GTP-bound form), with itself, and with Vps33p. ivy1-ivy1-1 3 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 2 Figure 2 ivy1-vps33-2 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 2 Two-hybrid system interactions of Ivy1p. Ivy1p yields positive lacZ assay results with the transport GTPase Ypt7p (wild-type), the mutant GTPases Ypt7(T22N)p (predominantly in the GDP-bound form) and Ypt7(Q68L)p (predominantly in the GTP-bound form), with itself, and with Vps33p. ivy1-ypt7-5 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P32939:p.Thr22Asn mutation mutation certain certain sequence position certain certain certain sequence position certain T N Wed May 02 18:36:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 15:57:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' physical association physical association After a thorough analysis of the obtained two-hybrid system candidate clones, the gene YDR229w (named IVY1 for: Interacting with Vps33p and Ypt7p) was singled out as the only new protein faithfully interacting with the GTP-binding protein Ypt7p. ivy1-ypt1 1 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3b Matrices loaded with GST-Ypt1p (an ER-Golgi transport GTPase) are able to bind minute amounts of Ivy1p when Ypt1p is activated by GTP.