IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis COP10 is a ubiquitin-conjugating enzyme variant that acts together with COP1 and the COP9 signalosome in repressing photomorphogenesis. Arabidopsis COP10 is a ubiquitin-conjugating enzyme variant that acts together with COP1 and the COP9 signalosome in repressing photomorphogenesis. Genes Dev. (0890-9369) 2002 imex curation Suzuki G., Yanagawa Y., Kwok SF., Matsui M., Deng XW. xingwang.deng@yale.edu orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki G., Yanagawa Y., Kwok SF., Matsui M., Deng XW. xingwang.deng@yale.edu Accepted 2009-SEP-27 by ORCHARD. Genes Dev. (0890-9369) 2002 orchard Only protein-protein interactions imex curation cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA DIP protein P43254 original sequence version: 138 DIP protein P43254 original sequence version: 113 DIP protein P43254 original sequence version: 114 E6D9A1B702EAE8F0 cop10_arath Constitutive photomorphogenesis protein 10 COP10 MRP15.21 At3g13550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMTPGGSGRLRPLPTAMYAGYSGTASSWVAKTSVSASGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFAK 6F255A398ECE901E csn3_arath COP9 signalosome complex subunit 3 Protein FUSCA 11 CSN3 FUS11 At5g14250 F18O22.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGAVNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGLVKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 77AD165F559BCE12 csn4_arath COP9 signalosome complex subunit 4 Constitutive photomorphogenesis protein 8 Protein FUSCA 4 CSN4 COP8 FUS4 At5g42970 MBD2.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV 1E8AEF28C35B28F0 csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH D182ABACE4238759 cop10-cop1-1 1 2 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind range range range range 3 unspecified role unspecified role bait bait physical association physical association Figure 4B Interaction of COP10 with truncated COP1 proteins. The authors do not give coordinates of the constructs used , therefore the RING-finger domain binding COP10 is provided from the UniProt record of this protein and presented as fuzzy coordinates to indicate the data was not provided by the authors. cop10-csn8 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Figure 4b interactions between COP10 and three distinct COP9 signalosome subunits (CSN3, CSN4 and CSN8) in our yeast two hybrid assay The coordinates of the truncated CSN proteins were not provided in the paper and were therefore not curated. cop10-csn3 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Figure 4b The coordinates of the truncated CSN proteins were not provided in the paper and were therefore not curated. cop10-csn4 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Figure 4b The coordinates of the truncated CSN proteins were not provided in the paper and were therefore not curated.