IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Role of the spindle pole body of yeast in mediating assembly of the prospore membrane during meiosis. Role of the spindle pole body of yeast in mediating assembly of the prospore membrane during meiosis. EMBO J. (0261-4189) 2000 imex curation Knop M., Strasser K. knop@biochem.mpg.de 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Knop M., Strasser K. knop@biochem.mpg.de Accepted 2009-MAR-19 by ORCHARD. 09-April-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard Only protein-protein interactions imex curation Role of the spindle pole body of yeast in mediating assembly of the prospore membrane during meiosis. Role of the spindle pole body of yeast in mediating assembly of the prospore membrane during meiosis. EMBO J. (0261-4189) 2000 imex curation Knop M., Strasser K. knop@biochem.mpg.de 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Knop M., Strasser K. knop@biochem.mpg.de Accepted 2009-MAR-19 by ORCHARD. 09-April-2009: Contacted by JYOTI. EMBO J. (0261-4189) 2000 orchard Only protein-protein interactions imex curation nud1_yeast Protein NUD1 YOR373W NUD1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDMDTQEAELSSQLENLTINSPRKLRSNAHSNSGKVFKEYESNHDFQDSNFTSQVVEPAISDSVKKPPTMTVLNNYSTVHQKVPSGFSGTTATSHQEAQWKQYFPGIGSGGGTNFGGAVGTANKVPESDLIVSDLVKDLSGVLETNTFKRHLDMKNKTTTMQTHENHDTISISHSKDFFNAEKVSSSFSDDSDSGPAAEAHDVFDGILQKQKSNYLVGSYPSNSNNKNNNNNNNNNNNNSININNKDNARTKEEDEEDTSNSFEFSSSSSMSSSQTQSGRKSKVLKKPPLNTISPGQLGYQFNHTHGAWDPPLNQGLDVSSSHSLDNTSSNQSQFATMVPTGDNHTNGKAPSILDKKAYELTSTKPGDVGYRQKKIQEEENLANSDDTPLDTPKFNDLFTKNGTRAKVKGQMRTSRSISNSNLLEAHKKLKTFPAERVEDITSISEVNTSFNETEKQLISILTSKLSGSPSYDSDWEKILKVDLSRGKLKNMFGMQRLLPNVLVLNLSDNEMNTLEGIPSNVVQLFCSNNKITSAHCSLAGFHDLECLDLSYNLLNTSLKFLSLCHHLQEVNLSYNSIQSLEGIGSSRMKKLNLSNNEINGIIDFEQLILTNNSVVGGWLTVEVLDLSNNNIIGVRNINCLPRLKVLNLNGNPLVSIVESSKMENGTLRALSIKNTGGALSKLQNYKLDDQFTFPYQNLKILKLDGFAQLSKWQKWPATLQILEINGGLASSLPRFSSLKSTNLYSLTIANVRDFTHLPVDLSKELPFLQELHLPGNNLQNAHKLTKTLPRQSVKFLDLRNNPITTPRHDRASTSLHYRQLLQLAGLCQQQCPALATLWLDDTPAPTATNL CB9F0408633C1315 mpc70_yeast Sporulation-specific protein 21 Meiotic plaque component protein 70 SPO21 MPC70 YOL091W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDNILKASNMEGTSTMTVTSRSSEDSSCISNHEQDTDTHKDGDTSGLENSKISKRKWMKEFFKLSKSPASKSSRSIGSMKSNQSLVSMKSSDDGNSYKNDYSSICGNSLPSAGLSRSNSVKELKLDSTGSQRSKNNVAMLARSSTTSQTTCSSSSSSSSYNSIKGNENDILLQNNNHFRHNKEIPQSKGSSNINTASIMSQYNVDTQATAIMSDMQKQYDSQQMTSPFVNEDLHFDPNGEVSHVIKAIFKEIGYKYDDFSDIPVFQLMQEMYQLVKKNSSARRTKITDYASKLKEKEAQLKSQNDKILKLETTNKAYKTKYKEVSLENKKIKEAFKELDNESYNHDEELLKKYKYTRETLDRVNREQQLIIDQNEFLKKSVNELQNEVNATNFKFSLFKEKYAKLADSITELNTSTKKREALGENLTFECNELKEICLKYKKNIENISNTNKNLQNSFKNERKKVLDLRNERNLLKKEILLIECHGSYSLLLVSNILTCYRFLLPSDTIIETESLIKELLNMNNSLSNHVSSSDEPPAEYSKRLELKCVEFEEKLLYFYQELVTKKIIDVIYKCFINYYKKSRQTDQKSNQNSSTPYKQSQRQVPHSIK E216B0C9B865B412 E216B0C9B865B412 cnm67_yeast Chaotic nuclear migration protein 67 CNM67 N1264 YNL225C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDFDLMNFPFHERLDSPVSENGEIKDGEPIPQNWLNENHVGKSILPLFVNPEDVINCNFSNARDSYEENKSPSMDQMNYARNTSYQESPGLQERPKNEKDKSPIGTDVHKKDVPNFIHSTPRENSSKHFTRANEQASAQPTDEHTSPDISIEDCNGAKIFLQNSLSKEDFRMLENVILGYQKKVIELGRDNLRQEERANSLQKELEAATKSNDKTLDNKKKIEEQTVLIENLTKDLSLNKEMLEKANDTIQTKHTALLSLTDSLRKAELFEIPIGILFFDLYDSEENSSKLDHILQEKYPNIKGFLCASQQEELSRISQRFKNAKAEAEDLRNELENKKIEIQTMREKNNTLIGTNKTLSKQNKILCDKFDKLTIDEKEILKGCNEEIKIKLERLNERLGSWEKSKEKYETSLKDKEKMLADAEKKTNTLSKELDNLRSRFGNLEGNTSERITIKNILQSRPDISAEECNFLMVEQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNFAQRLHRQVYSQEMNLKKFTDQAYYDFMSTRRMDSIDHHLERCLDHLYDHILEKMVK C4DE7631A70E695A C4DE7631A70E695A spc42_yeast Spindle pole body component SPC42 SPC42 YKL255 YKL042W protein protein yeast Saccharomyces cerevisiae Baker's yeast MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPKHRAPDATGNPRTTNKVSNTSDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQEPKRYNPTVKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQELQSMMDGDDNIKLDNVSKHNHATHRHSSQSSRDYSPSSDACLECSNDLYEKNRVKPENNMSETFATPTPNNR E3B56573FF516CE2 mpc54_yeast Meiotic plaque component protein 54 MPC54 YOR177C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPEDTSYSNSFEDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEINKNNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQLLEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMNDNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDNVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 74C614223B385CAC 74C614223B385CAC mpc70-mpc70 2 4 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 4a Mpc70p interacts strongly with itself. These interactions were independent of which domain was fused to the lexA DNA-binding domain and to the Gal4 activation domain. mpc70-mpc54 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4a Mpc70p interacts strongly with full-length Mpc54p. These interactions were independent of which domain was fused to the lexA DNA-binding domain and to the Gal4 activation domain. mpc70-nud1 2 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2272719]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 852-852, sequence length 851 [EBI-2272719]405-852 physical association physical association Figure 4a Mpc70p interacts strongly with the C-terminal half of Nud1p (aa405-852). These interactions were independent of which domain was fused to the lexA DNA-binding domain and to the Gal4 activation domain. mpc70-spc42 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4a Mpc70p also showed interactions with Spc42p and the C-terminal domain of Cnm67p. These interactions, however, were observed only for one direction in the two-hybrid assay. mpc70-cnm67 2 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association Figure 4a Mpc70p also showed interactions with the C-terminal domain of Cnm67p (aa386-580). These interactions, however, were observed only for one direction in the two-hybrid assay. mpc54-mpc54 2 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 31 29 physical association physical association Figure 4a For Mpc54p, self-interactions of the full-length proteins as well as the N-terminal and the coiled-coil domains were observed. mpc54-nud1 2 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2272731]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 852-852, sequence length 851 [EBI-2272731]405-852 physical association physical association Figure 4a Mpc54p interacts with the C-terminal domain of Nud1p. mpc54-spc42 2 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Figure 4a Mpc54p interacts with the C-terminal domain of Nud1p and with Spc42p. mpc54-nud1-1 1 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4b For Mpc54p, we identified conditions (salt concentration, ion chelators) for the SPB fraction under which only a subset of SPB components, in this case Nud1p, co-precipitated (Figure 4B). None of the other SPB components tested (Cnm67p, Spc42p, Kar1p, Spc72p, Spc97p, Spc98p) co-precipitated under these conditions (not shown). This confirms the two-hybrid interaction of Mpc54p with Nud1p and points to a direct interaction of Mpc54p with Nud1p. mpc70-mpc54-1 2 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Figure 4a Mpc70p interacts strongly with full-length Mpc54p. These interactions were independent of which domain was fused to the lexA DNA-binding domain and to the Gal4 activation domain. mpc70-nud1-1 2 3 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2272728]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 852-852, sequence length 851 [EBI-2272728]405-852 4 unspecified role unspecified role bait bait physical association physical association Figure 4a Mpc70p interacts strongly with the C-terminal half of Nud1p. These interactions were independent of which domain was fused to the lexA DNA-binding domain and to the Gal4 activation domain.