IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysis of the MRP8-MRP14 protein-protein interaction by the two-hybrid system suggests a prominent role of the C-terminal domain of S100 proteins in dimer formation. Analysis of the MRP8-MRP14 protein-protein interaction by the two-hybrid system suggests a prominent role of the C-terminal domain of S100 proteins in dimer formation. J. Biol. Chem. (0021-9258) 1999 imex curation Propper C., Huang X., Roth J., Sorg C., Nacken W. The beta galactosidase activity was used to determine the strength of interaction. nacken@uni-muenster.de,nacken@uni-muenster.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Propper C., Huang X., Roth J., Sorg C., Nacken W. The beta galactosidase activity was used to determine the strength of interaction. nacken@uni-muenster.de,nacken@uni-muenster.de Accepted 2008-DEC-19 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 1999 orchard Only protein-protein interactions imex curation s10a8_human Protein S100-A8 S100A8 CAGA MRP8 CFAG S100 calcium-binding protein A8 Calgranulin-A Migration inhibitory factor-related protein 8 Cystic fibrosis antigen Leukocyte L1 complex light chain Calprotectin L1L subunit Urinary stone protein band A protein protein human Homo sapiens Human MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE 78F589140B9CE166 s10a9_mouse Protein S100-A9 S100a9 Cagb Mrp14 S100 calcium-binding protein A9 Calgranulin-B Migration inhibitory factor-related protein 14 Leukocyte L1 complex heavy chain protein protein mouse Mus musculus Mouse MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK F4DCFBD1A181F812 mrp14-hummus N-terminal Human and C-terminal Mouse protein protein human Homo sapiens Human MTCKMSQLERNIETIINTFHQYSVKLGHPDTLRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK An amino acid sequence which is not represented in UniProt 7C6BBCE4D07DC705 mrp14-mushum N terminal Mrp14 Mouse and C-terminal MRP14 Human protein protein mouse Mus musculus Mouse MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP An amino acid sequence which is not represented in UniProt 32C62342BC704FE0 s10a9_human Protein S100-A9 S100 calcium-binding protein A9 Calgranulin-B Migration inhibitory factor-related protein 14 Leukocyte L1 complex heavy chain Calprotectin L1H subunit S100A9 CAGB CFAG MRP14 protein protein human Homo sapiens Human MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP C3BE19729E14C078 s10a8_mouse Protein S100-A8 S100a8 Caga Mrp8 S100 calcium-binding protein A8 Calgranulin-A Migration inhibitory factor-related protein 8 Leukocyte L1 complex light chain Chemotactic cytokine CP-10 Pro-inflammatory S100 cytokine protein protein mouse Mus musculus Mouse MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE D2AFF46ACE867A28 mrp8-mrp14 1 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 109 units 3 The mouse MRP8 and MRP14 readily form homodimeric molecules, although this interaction was significantly weaker than the heterodimeric complex formation. mrp8-mrp14-1 1 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 92 units 3 The mouse MRP8 and MRP14 readily form homodimeric molecules, although this interaction was significantly weaker than the heterodimeric complex formation. mrp8-mrp8-1 1 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 32 units 3 The mouse MRP8 and MRP14 readily form homodimeric molecules, although this interaction was significantly weaker than the heterodimeric complex formation. mrp14-mrp14 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P31725:p.Phe20Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A Wed May 02 20:31:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe20ala' Tue Jun 30 17:57:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe20Ala' P31725:p.Phe89Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:38:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe89ala' Tue Jun 30 19:17:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe89Ala' P31725:p.Leu95Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:02:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu95ala' Tue Jun 30 18:58:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu95Ala' physical association physical association author score author-based confidence author score 28 units 3, 4 Table1 The mouse MRP8 and MRP14 readily form homodimeric molecules, although this interaction was significantly weaker than the heterodimeric complex formation. mrp8-mrp14-2 1 6 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 89 units 3 mrp8-mrp14-3 1 2 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P06702:p.Cys3Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:22:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys3ser' Tue Jun 30 15:51:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3Ser' physical association physical association author score author-based confidence author score 84 units 3, table 1 hmmrp14-mrp8 1 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score 64 units Table1 mhmrp14-mrp8-1 1 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score 52 units Table1