UniProt UniProt http://www.uniprot.org CNS1 encodes an essential p60/Sti1 homolog in Saccharomyces cerevisiae that suppresses cyclophilin 40 mutations and interacts with Hsp90. CNS1 encodes an essential p60/Sti1 homolog in Saccharomyces cerevisiae that suppresses cyclophilin 40 mutations and interacts with Hsp90. Mol. Cell. Biol. 18 (7344-7352) 1998 imex curation Dolinski KJ., Cardenas ME., Heitman J. heitm001@mc.duke.edu 25-Jun-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dolinski KJ., Cardenas ME., Heitman J. heitm001@mc.duke.edu Accepted 2008-JUL-16 by ORCHARD. 25-Jun-2008: Contacted by JYOTI. Mol. Cell. Biol. 18 (7344-7352) 1998 orchard Only protein-protein interactions imex curation CNS1 encodes an essential p60/Sti1 homolog in Saccharomyces cerevisiae that suppresses cyclophilin 40 mutations and interacts with Hsp90. CNS1 encodes an essential p60/Sti1 homolog in Saccharomyces cerevisiae that suppresses cyclophilin 40 mutations and interacts with Hsp90. Mol. Cell. Biol. 18 (7344-7352) 1998 imex curation Dolinski KJ., Cardenas ME., Heitman J. heitm001@mc.duke.edu 25-Jun-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dolinski KJ., Cardenas ME., Heitman J. heitm001@mc.duke.edu Accepted 2008-JUL-16 by ORCHARD. 25-Jun-2008: Contacted by JYOTI. Mol. Cell. Biol. 18 (7344-7352) 1998 orchard Only protein-protein interactions imex curation CNS1 encodes an essential p60/Sti1 homolog in Saccharomyces cerevisiae that suppresses cyclophilin 40 mutations and interacts with Hsp90. CNS1 encodes an essential p60/Sti1 homolog in Saccharomyces cerevisiae that suppresses cyclophilin 40 mutations and interacts with Hsp90. Mol. Cell. Biol. 18 (7344-7352) 1998 imex curation Dolinski KJ., Cardenas ME., Heitman J. heitm001@mc.duke.edu 25-Jun-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dolinski KJ., Cardenas ME., Heitman J. heitm001@mc.duke.edu Accepted 2008-JUL-16 by ORCHARD. Mol. Cell. Biol. 18 (7344-7352) 1998 orchard Only protein-protein interactions imex curation cyp7_yeast Peptidyl-prolyl cis-trans isomerase CYP7 CPR7 YJR032W J1585 Rotamase CYP7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIQDPLVYLDISIDKKPIGRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLSYKGNGFHRVVKNFMIQAGDIVFGTQKDSSSSSVGKGGCSIYADKEEVKTDDESFCYGNFEDENLGEFVEPFTLGMANLGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGKSVVRTIENCRVDSDGVPESDVRISDCGVWEKTMGVPLYNASNDQIGGDVYEEYPDDDTHFGDDDFGKALEAANIIKESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPDVDKERNIQFINLKMKIYLNLSLVLFNLERYDDAIMYATYLLEMDNVPNRDQAKAYYRRGNSYLKKKRLDEALQDYIFCKEKNPDDEVIEQRIEYVNRLIEENKEKTRKNISKFFS 1532F255E8016F4F 1532F255E8016F4F hsc82_yeast ATP-dependent molecular chaperone HSC82 HSC82 YMR186W YM8010.16 Heat shock protein Hsp90 constitutive isoform 82 kDa heat shock cognate protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPDLFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNEDEQYIWESNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDEEKKDEDDKKPKLEEVDEEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFDKFYSAFAKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEYEPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLFETALLTSGFSLEEPTSFASRINRLISLGLNIDEDEETETAPEASTEAPVEEVPADTEMEEVD DBD41524091B1F9B DBD41524091B1F9B cns1_yeast Hsp70/Hsp90 co-chaperone CNS1 CNS1 YBR155W YBR1205 Cyclophilin seven suppressor 1 STI1 stress-inducible protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSVNANGGYTKPQKYVPGPGDPELPPQLSEFKDKTSDEILKEMNRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENKKIMLESAMTLRNITNIKTHSPVELLNEGKIRLEDPMDFESQLIYPALIMYPTQDEFDFVGEVSELTTVQELVDLVLEGPQERFKKEGKENFTPKKVLVFMETKAGGLIKAGKKLTFHDILKKESPDVPLFDNALKIYIVPKVESEGWISKWDKQKALERRSV 742F8254DFDB02A6 742F8254DFDB02A6 csn1-hsc82 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 7A cpr7-cns1 2 6 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 8A & 8B The interaction is disrupted by cyclosporin A but not geldanamycin suggesting that the cyclophilin domain of Cpr7 participates in binding to Cns1. cpr7-cns1-1 1 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 8C Cyclosporin A as well as geldanamycin do not have any effect on the Cpr7-Hsc82 interaction.