MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage. The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage. J. Cell Biol. (0021-9525) 1998 Balsamo J., Arregui C., Leung T., Lilien J. Phosphatases suggested by tinti rapid curation chick-retina Gallus gallus retina retinal tissue coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Balsamo J., Arregui C., Leung T., Lilien J. Phosphatases suggested by tinti suggested by tinti J. Cell Biol. (0021-9525) 1998 rapid curation The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage. The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage. J. Cell Biol. (0021-9525) 1998 Balsamo J., Arregui C., Leung T., Lilien J. Phosphatases suggested by tinti rapid curation human-ln Homo sapiens ln ln coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Balsamo J., Arregui C., Leung T., Lilien J. Phosphatases suggested by tinti suggested by tinti J. Cell Biol. (0021-9525) 1998 rapid curation The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage. The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage. J. Cell Biol. (0021-9525) 1998 Balsamo J., Arregui C., Leung T., Lilien J. Phosphatases suggested by tinti rapid curation chick-retina Gallus gallus retina retinal tissue density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Balsamo J., Arregui C., Leung T., Lilien J. Phosphatases suggested by tinti suggested by tinti J. Cell Biol. (0021-9525) 1998 rapid curation cadh2_chick Cadherin-2 Neural cadherin CDH2 protein protein chick Gallus gallus (Chicken) Chicken MCRIAGTPPRILPPLALMLLAALQQAPIKATCEDMLCKMGFPEDVHSAVVSRSVHGGQPLLNVRFQSCDENRKIYFGSSEPEDFRVGEDGVVYAERSFQLSAEPTEFVVSARDKETQEEWQMKVKLTPEPAFTGASEKDQKKIEDIIFPWQQYKDSSHLKRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKSLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIASFHLRAHAVDVNGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAQNGMLRYRILSQAPSSPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNARYQMTGGDPTGQFTILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSITVIDVNESPYFVPNPKLVRQEEGLLAGSMLTTFTARDPDRYMQQTSLRYSKLSDPANWLKIDPVNGQITTTAVLDRESIYVQNNMYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVNPKEATTCETLQPNAINITAVDPDIDPNAGPFAFELPDSPPSIKRNWTIVRISGDHAQLSLRIRFLEAGIYDVPIVITDSGNPHASSTSVLKVKVCQCDINGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD DIP protein P10288 original sequence version: 119 DIP protein P10288 original sequence version: 62 9BA5AC9DC1FFC489 ptn1_chick Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B CPTP1 protein protein chick Gallus gallus (Chicken) Chicken MEIEKEFHRLDQAASWAAIYQDIRHEASDFPCKVAKHPRNKNRNRYRDVSPFDHSRIKLNQGDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSIKCAQYWPRKEEKEMFFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPVVVHCSAGIGRSGTFCLVDTCLLLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQEQWKELSNEDLDPPPEHTPPPPRPPKRTSEMHNGRMHEHAEFFPKHQVVEEEIRCSVSTAEETVSDGRVFSSVPLITDSTSQDTEIRRRTVGENLHVTAHKEESKSESVEEDDENMMTTWKPFLVNICMFTFLTAGAYLCYRVCFH May play an important role in CKII- and p60c-src-induced signal transduction cascades mint homomint 0FF340B2333CC311 o42486_chick Bcat protein protein chick Gallus gallus (Chicken) Chicken MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTTQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVLSAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGGTAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRPDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL 6D205D9A4DBAC562 cdh2-ptpn1-5 2 PTP-1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N-Cadherin 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2B homomint mint cdh2-ptpn1-6 1 PTP1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N-Cadherin 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2B homomint mint cdh2-ptpn1-7 3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F2 homomint mint cdh2-ptpn1-8 2 PTP1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme enzyme prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined N-Cadherin 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F7 homomint mint cdh2-chbcat-4 2 N-Cadherin 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Beta catenin 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5 homomint mint cdh2-ptpn1-9 2 PTP1B 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme enzyme prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined N-Cadherin 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F9 homomint mint