IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. FEBS Lett. (0014-5793) 1998 Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Accepted 2008-AUG-22 by JYOTI. Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). FEBS Lett. (0014-5793) 1998 jyoti An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. FEBS Lett. (0014-5793) 1998 Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Accepted 2008-AUG-22 by JYOTI. Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). FEBS Lett. (0014-5793) 1998 jyoti An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. FEBS Lett. (0014-5793) 1998 Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). jyoti in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Accepted 2008-AUG-22 by JYOTI. Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). FEBS Lett. (0014-5793) 1998 jyoti remo_arath Remorin DBP F4I18.20 At2g45820 DNA-binding protein protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEEQKTSKVDVESPAVLAPAKEPTPAPVEVADEKIHNPPPVESKALAVVEKPIEEHTPKKASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATGVVPKATCGCF 092A817CF7E1B476 y3126_arath Uncharacterized protein At3g61260 T20K12.160 At3g61260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEEQKIALESESPAKVTTPAPADTPAPAPAEIPAPAPAPTPADVTKDVAEEKIQNPPPEQIFDDSKALTVVEKPVEEPAPAKPASASLDRDVKLADLSKEKRLSFVRAWEESEKSKAENKAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEETAAKYRATGIVPKATCGCF 9A02C8148DA8539B arr4_arath Two-component response regulator ARR4 Response regulator 1 ARR4 ATRR1 IBC7 At1g10470 T10O24.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARDGGVSCLRRSEMMSVGGIGGIESAPLDLDEVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDNEKASAEFDRLKVDLIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVKLADVKRLRSHLTKDVKLSNGNKRKLPEDSSSVNSSLPPPSPPLTISPESSPPLTVSTESSDSSPPLSPVEIFSTSPLSSPIDDEDDDVLTSSSEESPIRRQKMRSPGLD 557A4E2DA51948F5 arr4-dbp 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 1 Henceforth, the previously characterized AtDBP was designated as AtDBP1 (Clone-A and -B), whereas the newly identified homologue was designated as AtDBP2 (Clone-C). In any case, these results are convincing enough for us to believe that these fishes are not false positives, and that the identified AtDBPs may exhibit an ability to interact with ARR4. arr4-at3g61260 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1 Henceforth, the previously characterized AtDBP was designated as AtDBP1 (Clone-A and -B), whereas the newly identified homologue was designated as AtDBP2 (Clone-C). In any case, these results are convincing enough for us to believe that these fishes are not false positives, and that the identified AtDBPs may exhibit an ability to interact with ARR4. arr4-dbp-1 2 4 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 In contrast to the case of ARR4, neither the intact ARR3 nor the truncated ARR4-ΔC lacking the C-terminal region were not functional, as judged by the histidine-autotrophy. These results suggested that the common (or highly conserved) receiver domain is not sufficient for the presumed ARR4-AtDBP1 interaction, and that the unique C-terminal region of ARR4 is responsible for the interaction The authors suggest that "the N-terminal region of AtDBP1 may exhibit an inhibitory effect on the interaction". arr4-dbp-2 3 4 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3 In vitro binding assay showing a specific interaction between ARR4 and AtDBP1