IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene. Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene. Plant J. (0960-7412) 1998 imex curation Cormack RS., Hahlbrock K., Somssich IE. Arabidopsis cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cormack RS., Hahlbrock K., Somssich IE. Accepted 2008-DEC-27 by JYOTI. Arabidopsis cDNA Plant J. (0960-7412) 1998 jyoti Only protein-protein interactions imex curation Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene. Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene. Plant J. (0960-7412) 1998 imex curation Cormack RS., Hahlbrock K., Somssich IE. Arabidopsis cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cormack RS., Hahlbrock K., Somssich IE. It was not possible to view the PDF associated with this paper. It was not possible to view Table 1, therefore details of directed two hybrid experiments are curated from the text , where possible. Because the bait / prey arrangements are not specified only homodimeric pairings could be curated. Accepted 2008-DEC-27 by JYOTI. Arabidopsis cDNA Plant J. (0960-7412) 1998 jyoti Only protein-protein interactions imex curation Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene. Isolation of putative plant transcriptional coactivators using a modified two-hybrid system incorporating a GFP reporter gene. Plant J. (0960-7412) 1998 imex curation Cormack RS., Hahlbrock K., Somssich IE. Arabidopsis cDNA jyoti Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cormack RS., Hahlbrock K., Somssich IE. Accepted 2008-DEC-27 by JYOTI. Arabidopsis cDNA Plant J. (0960-7412) 1998 jyoti Only protein-protein interactions imex curation prh_arath Pathogenesis-related homeodomain protein PRH PRHA F27B13.180 At4g29940 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEESETKGRISQETDKACVSVERIGSTLLSSFVKKGKEVSNKRNSKQNKRKAEEELCSKSRTKKYSRGWVRCEEMEEEKVKKTRKRKSKRQQKDNKVEVDDSLRLQRRTRYLLIKMKMQQNLIDAYATEGWKGQSREKIRPDKELERARKEILNCKLGLRDAIRQLDLLSSVGSMEEKVIASDGSIHHDHIFCAECNSREAFPDNDIILCDGTCNRAFHQKCLDPPLETESIPPGDQGWFCKFCDCKIEIIDTMNAQIGTHFPVDSNWQDIFNEEASLPIGSEATVNNEADWPSDDSKDDDYDPEMRENGGGNSSNVSGDGGGDNDEESISTSLSLSSDGVALSTGSWEGHRLSNMVEQCETSNEETVCGPRQRRTVDYTQLYYEMFGKDAVLQEQGSEDEDWGPNDRRKRKRESDAGSTLVTMCESSKKDQDVVETLEQSERDSVSVENKGGRRRMFRLPRNAVEKLRQVFAETELPSKAVRDRLAKELSLDPEKVNKWFKNTRYMALRNRKTESVKQPGDSKTVSGGDSGPEAVMENNTETNEVQDTLDDTVPPGFDATNQNILSPCNNNQEEFQQENVSFPSPTDESQQYLEQNDSSFVLVPHEKQSSEISLKTAVEENETESKMMKEPHEELSSEMSLKTAAEEKETESKMIEEPHEELSREMSLKTAVEEKETESKMMEEPHDELNSEMSLSTAVEEKETGSKMTEESHEELSNEMSLEEKETGRKMTEEEELEAVMEMLCRTENKLLDVTQRLDRFKTPKGRKKLGNSSSPLLEEDSVVYVPIAEIKEKR 5E61509A0CAD6175 kiwi_arath RNA polymerase II transcriptional coactivator KIWI KIWI T5E8_50 At5g09250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRGKRKDEDVRASDDESETHAPAKKVAKPADDSDQSDDIVVCNISKNRRVSVRNWNGKIWIDIREFYVKDGKTLPGKKGISLSVDQWNTLRNHAEDIEKALSDLS 513F84BCCB240486 kelp_arath RNA polymerase II transcriptional coactivator KELP KELP F8M12.6 F25I24.130 At4g10920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKETKEKIEKTVIEILSESDMKEITEFKVRKLASEKLAIDLSEKSHKAFVRSVVEKFLDEERAREYENSQVNKEEEDGDKDCGKGNKEFDDDGDLIICRLSDKRRVTIQEFKGKSLVSIREYYKKDGKELPTSKGISLTDEQWSTFKKNMPAIENAVKKMESRV 6620F1693D40D3D1 prha-kiwi 1 5 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1 no suitable source text kiwi-kelp 1 6 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3 A library plasmid encoding the KIWI‐interacting protein was isolated and the sequence of the cDNA insert determined. The sequence of this clone, designated KELP, is similar to both KIWI and PC4/p15 (44% and 41% sequence identity, respectfully). Although not specifically stated by the authors it is assumed that the same Arabidopsis cDNA library used in the PRHA bait screen was used in this case. kiwi-1 2 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Table 1 KIWI is capable of associating with KELP (lines 4 and 7) and itself kelp 2 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 KELP can also homomerise kiwi-kelp-1 3 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 4 In order to confirm the observed interaction between KIWI and KELP, co‐immunoprecipitation experiments were carried out (Fig. 4). Antiserum directed against KIWI recognised the in vitro translated 35S‐labelled version (lane 1). When similarly labelled KELP protein was incubated with KIWI prior to addition of anti‐KIWI antibody this resulted in the precipitation not only of KIWI but also of KELP, thus demonstrating an in vitro protein�protein interaction kiwi-kelp-2 2 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association Table 1 kiwi-kelp-3 2 6 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Table 1