MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. FEBS Lett. (0014-5793) 2008 imex curation Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri 2008-12-03 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. FEBS Lett. (0014-5793) 2008 imex curation Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri 2008-12-03 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. FEBS Lett. (0014-5793) 2008 imex curation Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri 2008-12-03 Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. FEBS Lett. (0014-5793) 2008 imex curation Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri 2008-12-03 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling. FEBS Lett. (0014-5793) 2008 imex curation Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri 2008-12-03 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zou T., Ouyang L., Chen L., Dong W., Qiao H., Liu Y., Qi Y. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation map1s_mouse Microtubule-associated protein 1S Bpy2ip1 Map8 Mtap1s Map1s BPY2-interacting protein 1 Microtubule-associated protein 8 protein protein mouse Mus musculus Mouse MAAVMAAPEAVEAPSSLLLLVVGGECGCPGLLAYVMEELERGVRSWEDVDPAVCSLDEQLKAFVSRHSATFSSIVKGQRSLHHRGETLETLVLLNPSDKSLCDELRNLLMDPAPHKLLVLAGPCLEETGELLLQTGGFSAHHFLQVLGDKEVQDALASAPAAPALTVSCPTFGDWALLGPVPGLQLRLNPPAQLPASEGLRAFLEYVAESLEPPSPFELLEPPAAGGFLRLARPCCYVFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHAGADSLPGLNSLLRRKLAEREAAAGPQGQHEERLRRLLSPALGVVFLNAREAASRLRGGEDEAVCARSLLRSLGIAPLPLQRGPQPSCPTVLFEKLGVGRLELFVLHPPPGDPAAPACALLVWQPAAPGDKVVRVLFPGRTPPARLLDGLQRLQHLPCLRRPVVTTHDLEAPSRANSQDSLASRDSARKEPVRGTVGSIANRSTVRREPALATRDQKKDTRSGPTQPTARDTRRSGPGVVNTKPRVSQNGPRAPVLAAPLTAPVAECPGEAENILESERPPAPSPTLSPAQSPPPTAPGNSPERLSLSPLRPEPAPDASPSATTPTLTTPSLPAELGSPHSTEVDESLSVSFEQVLPAGDPGLSLPLRLARRSTSPHDVDLCLVSPCEFSHRKPPPPASPGSSDSSARSQERPPETPPTSVSESLPTLSDSDPVPVADSDDDAGSESAARDPPPTPRVPPPLPDVPGICMVDPEALPPRARQPLNTTNPSRSRKAPARPSSASATPRAATVAAKTKGPAGDRNRPLSARSEPADRPGRVPLTRKPSVPKTVPKMASATRLSSGPSGRPAPLAAGSPVYLDLAYLPGGGAGHLDQNFFLRVRALCYVISGQGQRQEEGLRAVLDALLAGKRQWDLDLQVTLIPTFDSAVMHRWYEETHAQHQALGIRVLGSGSLVSMQDEAFPACKVEF mint Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis (By similarity). Involved in the formation of microtubule bundles 3DD3E1A43F70E8DD map1s_human Microtubule-associated protein 1S MAP1S BPY2IP1 C19orf5 MAP8 VCY2IP1 BPY2-interacting protein 1 Microtubule-associated protein 8 Variable charge Y chromosome 2-interacting protein 1 protein protein human Homo sapiens Human MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVFVSRHSATFSSIVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGPCLEETGELLLQTGGFSPHHFLQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALRLQLRLNPPAQLPNSEGLCEFLEYVAESLEPPSPFELLEPPTSGGFLRLGRPCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHPGADSLPGLNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLARGEDEAELALSLLAQLGITPLPLSRGPVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHPAGPGEKVVRVLFPGCTPPACLLDGLVRLQHLRFLREPVVTPQDLEGPGRAESKESVGSRDSSKREGLLATHPRPGQERPGVARKEPARAEAPRKTEKEAKTPRELKKDPKPSVSRTQPREVRRAASSVPNLKKTNAQAAPKPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGSPASQLVATPSLELGPIPAGEEKALELPLAASSIPRPRTPSPESHRSPAEGSERLSLSPLRGGEAGPDASPTVTTPTVTTPSLPAEVGSPHSTEVDESLSVSFEQVLPPSAPTSEAGLSLPLRGPRARRSASPHDVDLCLVSPCEFEHRKAVPMAPAPASPGSSNDSSARSQERAGGLGAEETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAETHARHQALGITVLGSNSMVSMQDDAFPACKVEF 30AB33FFE26DDF91 socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL DIP protein O35718 original sequence version: 61 DIP protein O35718 original sequence version: 119 DIP protein O35718 original sequence version: 93 CD3859561D4CCDED socs3_human Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 STAT-induced STAT inhibitor 3 SOCS3 CIS3 SSI3 protein protein human Homo sapiens Human MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL 08581DC411EFFF19 socs3-map1s 1 SOCS3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MAP1S 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796892: original sequence: 814-1059 : EGFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAETHARHQALGITVLGSNSMVSMQDDAFPACKVE tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A homomint mint socs3-map1s-1 1 MAP1S 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796898: original sequence: 765-980 : DSSARSQERAGGLGAEETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVIS tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SOCS3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A homomint mint socs3-map1s-2 1 SOCS3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain BG loop range MINT-6796953: original sequence: 164-185 : AYYIYSGGEKIPLVLSRPLSS MAP1S 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A homomint mint socs3-map1s-3 5 MAP1S 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SOCS3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6797864: original sequence: 164-185 : AYYIYSGGEKIPLVLSRPLSS tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C homomint mint socs3-map1s-4 4 SOCS3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain BG loop range MINT-6796965: original sequence: 164-185 : AYYIYSGGEKIPLVLSRPLSS MAP1S 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B F2B homomint mint map1s-socs3 2 SOCS3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain BG loop range MINT-6796985: original sequence: 164-185 : AYYIYSGGEKIPLVLSRPLSS gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MAP1S 7 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F3 homomint mint socs3-map1s-5 3 MAP1S 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SOCS3 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1D Interaction occurs upon LPS stimulation homomint mint map1s-socs3-1 3 MAP1S 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level SOCS3 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1C Interaction occurs upon LPS stimulation homomint mint