MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Features of a twin-arginine signal peptide required for recognition by a Tat proofreading chaperone. Features of a twin-arginine signal peptide required for recognition by a Tat proofreading chaperone. FEBS Lett. (0014-5793) 2008 imex curation Buchanan G., Maillard J., Nabuurs SB., Richardson DJ., Palmer T., Sargent F. suggested by aryamontri 2008-12-02 Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Buchanan G., Maillard J., Nabuurs SB., Richardson DJ., Palmer T., Sargent F. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation Features of a twin-arginine signal peptide required for recognition by a Tat proofreading chaperone. Features of a twin-arginine signal peptide required for recognition by a Tat proofreading chaperone. FEBS Lett. (0014-5793) 2008 imex curation Buchanan G., Maillard J., Nabuurs SB., Richardson DJ., Palmer T., Sargent F. suggested by aryamontri 2008-12-02 Only protein-protein interactions ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Buchanan G., Maillard J., Nabuurs SB., Richardson DJ., Palmer T., Sargent F. suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation tora_ecoli Trimethylamine-N-oxide reductase 1 torA b0997 JW0982 protein protein ecoli Escherichia coli (strain K12) MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQAATDAVISKEGILTGSHWGAIRATVKDGRFVAAKPFELDKYPSKMIAGLPDHVHNAARIRYPMVRVDWLRKRHLSDTSQRGDNRFVRVSWDEALDMFYEELERVQKTHGPSALLTASGWQSTGMFHNASGMLAKAIALHGNSVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLQNSKTIVLWGSDLLKNQQANWWCPDHDVYEYYAQLKAKVAAGEIEVISIDPVVTSTHEYLGREHVKHIAVNPQTDVPLQLALAHTLYSENLYDKNFLANYCVGFEQFLPYLLGEKDGQPKDAAWAEKLTGIDAETIRGLARQMAANRTQIIAGWCVQRMQHGEQWAWMIVVLAAMLGQIGLPGGGFGFGWHYNGAGTPGRKGVILSGFSGSTSIPPVHDNSDYKGYSSTIPIARFIDAILEPGKVINWNGKSVKLPPLKMCIFAGTNPFHRHQQINRIIEGLRKLETVIAIDNQWTSTCRFADIVLPATTQFERNDLDQYGNHSNRGIIAMKQVVPPQFEARNDFDIFRELCRRFNREEAFTEGLDEMGWLKRIWQEGVQQGKGRGVHLPAFDDFWNNKEYVEFDHPQMFVRHQAFREDPDLEPLGTPSGLIEIYSKTIADMNYDDCQGHPMWFEKIERSHGGPGSQKYPLHLQSVHPDFRLHSQLCESETLRQQYTVAGKEPVFINPQDASARGIRNGDVVRVFNARGQVLAGAVVSDRYAPGVARIHEGAWYDPDKGGEPGALCKYGNPNVLTIDIGTSQLAQATSAHTTLVEIEKYNGTVEQVTAFNGPVEMVAQCEYVPASQVKS DIP protein P33225 original sequence version: null 59DDACB00B1843E7 tord_ecoli Chaperone protein TorD JW0983 b0998 torD protein protein ecoli Escherichia coli (strain K12) MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKSEPPLTAAVNELENRIATLTVRDDARLELAADFCGLFLMTDKQAALPYASAYKQDEQEIKRLLVEAGMETSGNFNEPADHLAIYLELLSHLHFSLGEGTVPARRIDSLRQKTLTALWQWLPEFVARCRQYDSFGFYAALSQLLLVLVECDHQNR F58357DA153FDE74 tord-tora-1 2 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796276: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B F4 mint tord-tora-2 2 TorA-G19Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P33225:p.Gly19Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G Q Tue Jul 12 10:17:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:21:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly19gln' Tue Jun 30 19:37:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly19Gln' range MINT-6796296: original sequence: 19-19 : ASRRRFLAQLGGLTVAGMLG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796283: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint tord-tora-3 2 TorA-T22Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796310: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ P33225:p.Thr22Gln mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T Q Tue Jul 12 10:16:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:18:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22gln' Tue Jun 30 20:08:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Gln' range MINT-6796306: original sequence: 22-22 : RRFLAQLGGLTVAGMLGPSL TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint tord-tora-4 2 TorA-V23Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P33225:p.Val23Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V Q Tue Jul 12 10:16:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:02:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val23gln' Tue Jun 30 15:42:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val23Gln' range MINT-6796319: original sequence: 23-23 : RFLAQLGGLTVAGMLGPSLL binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796321: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint tord-tora-5 2 TorA-L27Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P33225:p.Leu27Gln mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:24:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:58:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu27gln' Tue Jun 30 16:04:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu27Gln' range MINT-6796340: original sequence: 27-27 : QLGGLTVAGMLGPSLLTPRR binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796344: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint tord-tora-6 2 TorA-G28Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P33225:p.Gly28Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G Q Tue Jul 12 10:59:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:17:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly28gln' Tue Jun 30 16:56:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly28Gln' range MINT-6796354: original sequence: 28-28 : LGGLTVAGMLGPSLLTPRRA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796356: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint tord-tora-7 2 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P33225:p.Leu31Gln mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:23:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:09:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 17:03:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796379: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796383: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B F4A mint tord-tora-8 2 TorA-L32Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796397: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ P33225:p.Leu32Gln mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:22:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:18:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu32gln' Tue Jun 30 18:57:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Gln' range MINT-6796395: original sequence: 32-32 : TVAGMLGPSLLTPRRATAAQ TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint tord-tora-9 2 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796416: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P33225:p.Leu31Gln mutation decreasing interaction mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:22:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:44:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 17:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796414: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA TorDsupp1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P36662:p.Leu189Gln mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:22:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:16:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu189gln' Tue Jun 30 19:24:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu189Gln' range MINT-6796510: original sequence: 189-189 : GFYAALSQLLLVLVECDHQN tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36662:p.Phe180Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F L Tue Jul 12 10:22:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:18:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe180leu' Tue Jun 30 16:19:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe180Leu' range MINT-6796508: original sequence: 180-180 : ARCRQYDSFGFYAALSQLLL P36662:p.Gln7Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Tue Jul 12 10:22:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:54:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln7leu' Tue Jun 30 15:42:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln7Leu' range MINT-6796506: original sequence: 7-7 : MTTLTAQQIACVYAWL physical association physical association F4A mint tord-tora-10 2 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796439: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorDsupp1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P36662:p.Gln7Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Tue Jul 12 10:07:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:33:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln7leu' Tue Jun 30 17:16:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln7Leu' range MINT-6796497: original sequence: 7-7 : MTTLTAQQIACVYAWL P36662:p.Leu189Gln mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:08:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:13:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu189gln' Tue Jun 30 18:38:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu189Gln' range MINT-6796503: original sequence: 189-189 : GFYAALSQLLLVLVECDHQN tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36662:p.Phe180Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F L Tue Jul 12 10:50:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:40:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe180leu' Tue Jun 30 20:00:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe180Leu' range MINT-6796500: original sequence: 180-180 : ARCRQYDSFGFYAALSQLLL physical association physical association F4B mint tord-tora-11 2 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796450: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorDsupp2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P36662:p.Gln186Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Tue Jul 12 10:08:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:44:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln186leu' Tue Jun 30 17:31:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln186Leu' range MINT-6796486: original sequence: 186-186 : DSFGFYAALSQLLLVLVECD tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4B mint tord-tora-12 2 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P33225:p.Leu31Gln mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:09:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:54:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 15:54:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796476: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796470: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorDsupp2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36662:p.Gln186Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Tue Jul 12 10:05:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:18:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln186leu' Tue Jun 30 18:53:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln186Leu' range MINT-6796492: original sequence: 186-186 : DSFGFYAALSQLLLVLVECD physical association physical association F4A mint tora-tord-3 1 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796519: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F2A T1 mint tora-tord-4 1 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P33225:p.Leu31Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:49:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:00:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 17:55:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796584: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796573: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorD 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F2B T2 mint tora-tord-5 1 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796595: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TorD-Q7L 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P36662:p.Gln7Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Tue Jul 12 10:12:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:29:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln7leu' Tue Jun 30 16:46:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln7Leu' range MINT-6796703: original sequence: 7-7 : MTTLTAQQIACVYAWL his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction T1 mint tora-tord-6 1 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796636: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD-F180L 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P36662:p.Phe180Leu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F L Tue Jul 12 10:13:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:24:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe180leu' Tue Jun 30 16:00:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe180Leu' range MINT-6796714: original sequence: 180-180 : ARCRQYDSFGFYAALSQLLL his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction T1 mint tora-tord-7 1 TorA 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796654: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD-L189Q 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P36662:p.Leu189Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:09:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:16:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu189gln' Tue Jun 30 20:14:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu189Gln' range MINT-6796735: original sequence: 189-189 : GFYAALSQLLLVLVECDHQN his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction T1 mint tora-tord-8 1 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P33225:p.Leu31Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:09:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:05:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 17:34:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796678: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796676: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD-Q7L 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36662:p.Gln7Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L Tue Jul 12 10:51:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:59:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln7leu' Tue Jun 30 19:09:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln7Leu' range MINT-6796747: original sequence: 7-7 : MTTLTAQQIACVYAWL direct interaction direct interaction T2 mint tora-tord-9 1 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P33225:p.Leu31Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:12:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:36:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 16:48:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796754: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796756: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ TorD-F180L 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P36662:p.Phe180Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F L Tue Jul 12 10:11:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:18:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe180leu' Tue Jun 30 16:13:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe180Leu' range MINT-6796762: original sequence: 180-180 : ARCRQYDSFGFYAALSQLLL his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction T2 mint tora-tord-10 1 TorA-L31Q 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6796782: original sequence: 1-42 : MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATAAQ P33225:p.Leu31Gln mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:55:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:15:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31gln' Tue Jun 30 19:31:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Gln' range MINT-6796784: original sequence: 31-31 : LTVAGMLGPSLLTPRRATAA TorD-L189Q 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P36662:p.Leu189Gln mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L Q Tue Jul 12 10:55:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:32:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu189gln' Tue Jun 30 16:41:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu189Gln' range MINT-6796776: original sequence: 189-189 : GFYAALSQLLLVLVECDHQN his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction T2 mint