IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29. Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29. Plant Mol. Biol. (0167-4412) 2008 imex curation Barth O., Vogt S., Uhlemann R., Zschiesche W., Humbeck K. klaus.humbeck@pflanzenphys.uni-halle.de Arabidopsis cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Barth O., Vogt S., Uhlemann R., Zschiesche W., Humbeck K. klaus.humbeck@pflanzenphys.uni-halle.de Accepted 2008-DEC-7 by JYOTI. Arabidopsis cDNA library Plant Mol. Biol. (0167-4412) 2008 jyoti Only protein-protein interactions imex curation Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29. Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29. Plant Mol. Biol. (0167-4412) 2008 imex curation Barth O., Vogt S., Uhlemann R., Zschiesche W., Humbeck K. klaus.humbeck@pflanzenphys.uni-halle.de Arabidopsis cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Barth O., Vogt S., Uhlemann R., Zschiesche W., Humbeck K. klaus.humbeck@pflanzenphys.uni-halle.de Accepted 2008-DEC-7 by JYOTI. Arabidopsis cDNA library Plant Mol. Biol. (0167-4412) 2008 jyoti Only protein-protein interactions imex curation Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29. Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29. Plant Mol. Biol. (0167-4412) 2008 imex curation Barth O., Vogt S., Uhlemann R., Zschiesche W., Humbeck K. klaus.humbeck@pflanzenphys.uni-halle.de Arabidopsis cDNA library jyoti Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Barth O., Vogt S., Uhlemann R., Zschiesche W., Humbeck K. klaus.humbeck@pflanzenphys.uni-halle.de Accepted 2008-DEC-7 by JYOTI. Arabidopsis cDNA library Plant Mol. Biol. (0167-4412) 2008 jyoti Only protein-protein interactions imex curation zhd3_arath Zinc-finger homeodomain protein 3 ZHD3 HB21 Homeobox protein 21 ZFHD4 Zinc finger homeodomain transcription factor 4 T8K22.16 At2g02540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEIASQEDPIPINTSYGNSGGGHGNMNHHHHANSAPSSLNITTSNPLLVSSNSNGLGKNHDHSHHHHVGYNIMVTNIKKEKPVVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEALTCSVCNCHRNFHRRETEGEEKTFFSPYLNHHQPPPQQRKLMFHHKMIKSPLPQQMIMPIGVTTAGSNSESEDLMEEEGGGSLTFRQPPPPPSPYSYGHNQKKRFRTKFTQEQKEKMISFAERVGWKIQRQEESVVQQLCQEIGIRRRVLKVWMHNNKQNLSKKSNNVSNNVDLSAGNNDITENLASTNP BEE7142651C15321 hip24_arath Heavy metal-associated isoprenylated plant protein 24 HIPP24 T15F16.6 At4g08570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGVEGTMEYISDLLKKRKRKKKKQMQTVALRVARIDCEGCERKIKHVLSGVKGVKSVDVDVKLQKVTVTGYIDPKKVLEAAKSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNMVRKVPDTASVNETTVDDSYTIMFSDENPNSCAIM A4CBB89674CF0F74 hip21_arath Heavy metal-associated isoprenylated plant protein 21 HIPP21 K3M16_20 At5g17450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGAFDYISSFCSYTYANAKTKRKPLQTVDIKVKMDCDGCERRVRNVVRRMKGVKSVEVNRKQSRITVNGHVDPNKVLKRVKSTGKKAEFWPYIPQHMVYYPFAPGMYDKRAPAGHIRNPTQSFPTANAPEENYVSLFSDDNVHAACSIM 5F4AFB521FB8D6AC hip27_arath Heavy metal-associated isoprenylated plant protein 27 K2A18.19 At5g66110 HIPP27 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGFRDICYRKHHKKLKQFQKVEIKVKMDCEGCERRVRKSVEGMKGVSKVTVDPKQSKLTVEGFVQPSKVVHRVMHRTGKKAELWPYVPYEVVPHPYAPGAYDKKAPPGYVRNALADPLVAPLARASSFEVKYTSAFSDDNPNACTIM 4808F05FA8D354DF zhd8_arath Zinc-finger homeodomain protein 8 ZHD8 HB30 Homeobox protein 30 ZFHD3 Zinc finger homeodomain transcriptional factor ZFHD3 F8M21.100 At5g15210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDVIATTTTIVSDLDSRQPEIEAPIRIQPAKPISFSNGKRCHHHHLASEAVAVATYKECLKNHAAGIGGHALDGCGEFMPSPSFNSNDPASLTCAACGCHRNFHRREEDPSSLSAIVPAIEFRPHNRHQLPPPPPPHLAGIRSPDDDDSASPPPISSSYMLLALSGGRGGANTAVPMSRKRFRTKFSQYQKEKMFEFSERVGWRMPKADDVVVKEFCREIGVDKSVFKVWMHNNKISGRSGARRANGGVVVGGVGDSRQSVVPTNGSFSST 59F908DAD70DED76 hip30_arath Heavy metal-associated isoprenylated plant protein 30 HIPP30 Protein NPCC11 F8D23 At2g18196 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGFGSFISTITYCLFFRYPHKKPKFKSVSHLNHYHTMPMARPLSLQTIDLKVRMCCSGCERVVKHAIYKLRGVDSVEVNLEMERVTVVGYVERKKVLKAVRRAGKRAEFWPYPDMPRYFTSSDHYFKDTTREFRESYNYYRHGYNLSDRHGNIHVTNRGDDKMSNFFNDDNVHACSLM 4436E83D1755AE88 zhd11_arath Zinc-finger homeodomain protein 11 ZHD11 HB29 Transcription factor HB29 ZFHD1 Zinc finger homeodomain transcription factor 1 F24J1.29 At1g69600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSSKPQQQLLNSLPIAGELTVTGEMGVCYKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFLTAPPISSPSGTESPPSRHVSSPVPCSYYTSAPPHHVILSLSSGFPGPSDQDPTVVRSENSSRGAMRKRTRTKFTPEQKIKMRAFAEKAGWKINGCDEKSVREFCNEVGIERGVLKVWMHNNKYSLLNGKIREIEHGLCLNTHSNDGDGSSSS DIP protein Q9SEZ1 original sequence version: 84 9786B91E121EC5F4 hip26_arath Heavy metal-associated isoprenylated plant protein 26 HIPP26 FP6 Farnesylated protein 6 F20M13.140 At4g38580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGVLDHVSEMFDCSHGHKIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTLEPKAHKVTVVGYVDPNKVVARMSHRTGKKVELWPYVPYDVVAHPYAAGVYDKKAPSGYVRRVDDPGVSQLARASSTEVRYTTAFSDENPAACVVM 6156E2539E21F2A5 hip23_arath Heavy metal-associated isoprenylated plant protein 23 HIPP23 T19P19.90 At4g39700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKIKNSLSSLKGVKTVEINKKQQKVTVSGYADASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRKVDPNVTTGTMAVYYDDPSYTSLFSDDNPNACSIM 4B3FC92237EBE961 hip20_arath Heavy metal-associated isoprenylated plant protein 20 HIPP20 F23N20.4 At1g71050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGALDSLSEYISDYFRVTRKRRKRKVMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVEVNRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGYVRKSEQSQLQLLPGAPENHYISLFSDENPNACTVM AA804F713C490B68 hipp26-athb29 1 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Figure 4B All results clearly prove a specific interaction of HIPP26 with ATHB29, a zinc-finger homeodomain box transcription factor hipp26-athb29-1 3 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9SZN7:p.[Cys36Gly;Cys39Gly] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain C G Fri Jul 22 11:06:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys39gly,cys36gly' Wed May 02 15:21:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys36gly,cys39gly' Tue Jun 30 19:22:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys36Gly;Cys39Gly]' ecoli Escherichia coli (strain K12) physical association physical association Figure 4C The positions of the central cysteine residues within the M/L/IxCxxC core sequence was not provided by the authors. The coordinates of these residues was taken from the UniProt recrd for this protein. Our data from the two independent approaches indicate that HIPP26 interacts with the zinc-finger homeodomain box transcription factor ATHB29. For this interaction an intact heavy metal associated domain including the two central cysteines is important. hipp26-athb29-2 2 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Figure 5 in addition to HIPP26, also strongly interacts with HIPP20, HIPP21, HIPP23, HIPP24, HIPP27 and HIPP30 hipp20-athb29 2 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Figure 5 hipp21-athb29 2 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 5 hipp23-athb29 2 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Figure 5 hipp24-athb29 2 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Figure 5 hipp27-athb29 2 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Figure 5 hipp30-athb29 2 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Figure 5 hipp30-athb30 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Figure 5 The only other interactions detected were between HIPP30 and ATHB21 and ATHB30. hipp30-athb21 2 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Figure 5