IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proteolysis-Independent Downregulation of DELLA Repression in Arabidopsis by the Proteolysis-Independent Downregulation of DELLA Repression in Arabidopsis by the Plant Cell 2008 imex curation Ariizumi T, Murase K, Sun TP, Steber CM Transgenic Arabidopsis plants expressing FLAG tagged GID1L2 protein were used in this study. csteber@wsu.edu 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ariizumi T, Murase K, Sun TP, Steber CM Transgenic Arabidopsis plants expressing FLAG tagged GID1L2 protein were used in this study. csteber@wsu.edu Accepted 2009-OCT-8 by JYOTI. Plant Cell 2008 jyoti Only protein-protein interactions imex curation Proteolysis-Independent Downregulation of DELLA Repression in Arabidopsis by the Proteolysis-Independent Downregulation of DELLA Repression in Arabidopsis by the Plant Cell 2008 imex curation Ariizumi T, Murase K, Sun TP, Steber CM Transgenic Arabidopsis plants expressing FLAG tagged GID1L2 protein were used in this study. csteber@wsu.edu 27-Oct-2007: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ariizumi T, Murase K, Sun TP, Steber CM Transgenic Arabidopsis plants expressing FLAG tagged GID1L2 protein were used in this study. csteber@wsu.edu Accepted 2009-OCT-8 by JYOTI. 27-Oct-2007: Contacted by JYOTI. Plant Cell 2008 jyoti Only protein-protein interactions imex curation gid1a_arath Gibberellin receptor GID1A GID1A At3g05120 T12H1.8 GID1-like protein 1 CXE10 GID1L1 AtCXE10 Carboxylesterase 10 Protein GA INSENSITIVE DWARF 1A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASDEVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNAEC DIP protein Q9MAA7 original sequence version: 74 DIP protein Q9MAA7 original sequence version: 85 FE1ED6E13BC1A48D rga_arath DELLA protein RGA RGA GRS RGA1 At2g01570 F2I9.19 Repressor on the ga1-3 mutant GAI-related sequence Restoration of growth on ammonia protein 1 GRAS family protein 10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRDHHQFQGRLSNHGTSSSSSSISKDKMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATDTVHYNPSELYSWLDNMLSELNPPPLPASSNGLDPVLPSPEICGFPASDYDLKVIPGNAIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAGESTRSVILVDSQENGVRLVHALMACAEAIQQNNLTLAEALVKQIGCLAVSQAGAMRKVATYFAEALARRIYRLSPPQNQIDHCLSDTLQMHFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPTFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADLDASMLELRPSDTEAVAVNSVFELHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLSTAAY DIP protein Q9SLH3 original sequence version: 84 DIP protein Q9SLH3 original sequence version: 75 DIP protein Q9SLH3 original sequence version: 102 FC92E7F9408072AA gai_arath DELLA protein GAI GAI RGA2 At1g14920 F10B6.34 Gibberellic acid-insensitive mutant protein Restoration of growth on ammonia protein 2 GRAS family protein 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRDHHHHHHQDKKTMMMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLATETVHYNPAELYTWLDSMLTDLNPPSSNAEYDLKAIPGDAILNQFAIDSASSSNQGGGGDTYTTNKRLKCSNGVVETTTATAESTRHVVLVDSQENGVRLVHALLACAEAVQKENLTVAEALVKQIGFLAVSQIGAMRKVATYFAEALARRIYRLSPSQSPIDHSLSDTLQMHFYETCPYLKFAHFTANQAILEAFQGKKRVHVIDFSMSQGLQWPALMQALALRPGGPPVFRLTGIGPPAPDNFDYLHEVGCKLAHLAEAIHVEFEYRGFVANTLADLDASMLELRPSEIESVAVNSVFELHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEGVPSGQDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHIGSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLSTN DIP protein Q9LQT8 original sequence version: 77 DIP protein Q9LQT8 original sequence version: 78 DIP protein Q9LQT8 original sequence version: 105 DIP protein Q9LQT8 original sequence version: 86 6464B8C129D79528 gid1c_arath Gibberellin receptor GID1C GID1C At5g27320 F21A20.30 GID1-like protein 3 CXE19 GID1L3 AtCXE19 Carboxylesterase 19 Protein GA INSENSITIVE DWARF 1C protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGSEEVNLIESKTVVPLNTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKVPANANPVNGVFSFDVIIDRQTNLLSRVYRPADAGTSPSITDLQNPVDGEIVPVIVFFHGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAPENRYPCAYDDGWAVLKWVNSSSWLRSKKDSKVRIFLAGDSSGGNIVHNVAVRAVESRIDVLGNILLNPMFGGTERTESEKRLDGKYFVTVRDRDWYWRAFLPEGEDREHPACSPFGPRSKSLEGLSFPKSLVVVAGLDLIQDWQLKYAEGLKKAGQEVKLLYLEQATIGFYLLPNNNHFHTVMDEIAAFVNAECQ DIP protein Q940G6 original sequence version: 77 40B4C048B1FB6C15 gid1b_arath Gibberellin receptor GID1B GID1B At3g63010 T20O10.110 GID1-like protein 2 CXE14 GID1L2 AtCXE14 Carboxylesterase 14 Protein GA INSENSITIVE DWARF 1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGGNEVNLNECKRIVPLNTWVLISNFKLAYKVLRRPDGSFNRDLAEFLDRKVPANSFPLDGVFSFDHVDSTTNLLTRIYQPASLLHQTRHGTLELTKPLSTTEIVPVLIFFHGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSPEHRYPCAYDDGWNALNWVKSRVWLQSGKDSNVYVYLAGDSSGGNIAHNVAVRATNEGVKVLGNILLHPMFGGQERTQSEKTLDGKYFVTIQDRDWYWRAYLPEGEDRDHPACNPFGPRGQSLKGVNFPKSLVVVAGLDLVQDWQLAYVDGLKKTGLEVNLLYLKQATIGFYFLPNNDHFHCLMEELNKFVHSIEDSQSKSSPVLLTP DIP protein Q9LYC1 original sequence version: 78 8D24F47BC40CE4D4 gid1l2-rga 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 4 Increased Interaction of GID1b with DELLA RGA Protein Is Dependent on GA. Gibberellic acid The authors noted "RGA shows increasing interaction with FLAG:GID1b with increasing concentrations of GA3 in vivo". gid1l2-rga-1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association Supplementary Figure 7 In an in vitro GSTGID1 pull-down assay, GST-GID1a and GST-GID1b showed interaction with GAI only in the presence of GA, whereas GSTGID1c showed some interaction in the absence of GA and increased interaction in the presence of GA GST-GID1b showed interaction with GAI only in the presence of Gibberellic acid (GA). gi1l1-rga-2 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 7 In an in vitro GSTGID1 pull-down assay, GST-GID1a and GST-GID1b showed interaction with GAI only in the presence of GA, whereas GSTGID1c showed some interaction in the absence of GA and increased interaction in the presence of GA GST-GID1a showed interaction with GAI only in the presence of Gibberellic acid (GA). gi1l3-rga-3 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association Supplementary Figure 7 In an in vitro GSTGID1 pull-down assay, GST-GID1a and GST-GID1b showed interaction with GAI only in the presence of GA, whereas GSTGID1c showed some interaction in the absence of GA and increased interaction in the presence of GA