MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The zinc-binding protein Hot13 promotes oxidation of the mitochondrial import receptor Mia40. The zinc-binding protein Hot13 promotes oxidation of the mitochondrial import receptor Mia40. EMBO Rep. (1469-221X) 2008 imex curation Mesecke N., Bihlmaier K., Grumbt B., Longen S., Terziyska N., Hell K., Herrmann JM. 2008-11-28 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast biochemical biochemical western blot western blot Immuno blot Immuno blot Mesecke N., Bihlmaier K., Grumbt B., Longen S., Terziyska N., Hell K., Herrmann JM. EMBO Rep. (1469-221X) 2008 2008-11-28 Only protein-protein interactions imex curation The zinc-binding protein Hot13 promotes oxidation of the mitochondrial import receptor Mia40. The zinc-binding protein Hot13 promotes oxidation of the mitochondrial import receptor Mia40. EMBO Rep. (1469-221X) 2008 imex curation Mesecke N., Bihlmaier K., Grumbt B., Longen S., Terziyska N., Hell K., Herrmann JM. 2008-11-28 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down predetermined predetermined participant predetermined Mesecke N., Bihlmaier K., Grumbt B., Longen S., Terziyska N., Hell K., Herrmann JM. EMBO Rep. (1469-221X) 2008 2008-11-28 Only protein-protein interactions imex curation The zinc-binding protein Hot13 promotes oxidation of the mitochondrial import receptor Mia40. The zinc-binding protein Hot13 promotes oxidation of the mitochondrial import receptor Mia40. EMBO Rep. (1469-221X) 2008 imex curation Mesecke N., Bihlmaier K., Grumbt B., Longen S., Terziyska N., Hell K., Herrmann JM. 2008-11-28 Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Mesecke N., Bihlmaier K., Grumbt B., Longen S., Terziyska N., Hell K., Herrmann JM. EMBO Rep. (1469-221X) 2008 2008-11-28 Only protein-protein interactions imex curation mia40_yeast Mitochondrial intermembrane space import and assembly protein 40 YKL195W MIA40 TIM40 Mitochondrial import inner membrane translocase TIM40 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNLVVRNACRNRPSIQVARGLCRHQTRRLMASSPQFGRNSNQEKTAGFIMGILSMAGALYFIAPNRKPLFASRKVESDKTAEEELSSGGEQSPENEDDNNSKSDENGDDNDSKNDETEAGPQLGGDKIGASKVAEDGELVVLAEEDNKSSEDKDTDESKVSTKDDEQSNEDNATANNQKDENISSENSEENTSDKTLDNNAGSSEKKDPEHSDDEKSQQGQSDDKTTTEDNNGEEESSKKTVSDSENSAKQSESSDEEKEELRKQEEKQMGPTEEEVQHEGAYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLKETSDDEEPQDKVKVNTIESAPNVSSAKENAAKKAEQSDVKKEPLNEESKP 5904E8D0213D6EFA 5904E8D0213D6EFA cox17_yeast Cytochrome c oxidase copper chaperone COX17 L1343 YLL009C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN 7DA9A5F97C8A3F78 sodc_yeast Superoxide dismutase [Cu-Zn] SOD1 J1968 YJR104C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN E263A74679AF11F7 E263A74679AF11F7 fumh_yeast Fumarate hydratase, mitochondrial FUM1 YPL262W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK C099A02409A210E6 C099A02409A210E6 erv1_yeast Mitochondrial FAD-linked sulfhydryl oxidase ERV1 Essential for respiration and vegetative growth protein 1 14 kDa regulatory protein ERV1 YGR029W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWDE 83DADA0DB1DF17CC tim13_yeast Mitochondrial import inner membrane translocase subunit TIM13 G7157 YGR181W TIM13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQNASASGEI B1DDFE87AFDC52A3 hot13_yeast Helper of Tim protein 13 YKL084W HOT13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIETAIYGKTVDDQSRCVHWHLPKDVIAIRFKCCDKYYACFECHQELSSHPLEKYDLLDDANKHLIICGVCRHEMTFAEYYDYNSNLICPNCRSPFNPGCKLHYHLYFQNPPPAMC 57464E5FD9A591F8 cox17-erv1 1 ERV1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level COX17 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level TIM13 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MIA40 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level SOD1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level FUMARASE 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F2A homomint mint hot13-erv1 2 ERV1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level HOT13 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3A mint erv1-mia40 2 ERV1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MIA40 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3A homomint mint erv1-mia40-1 3 ERV1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified MIA40 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6801996: original sequence: 284-403 : AYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLKETSDDEEPQDKVKVNTIESAPNVSSAKENAAKKAEQSDVKKEPLNEESK direct interaction direct interaction F4A homomint mint